BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11e12 (694 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF100660-1|AAC68970.2| 442|Caenorhabditis elegans Hypothetical ... 29 4.2 AF016450-13|AAB65988.2| 472|Caenorhabditis elegans Hypothetical... 28 7.3 Z93388-12|CAB07661.2| 294|Caenorhabditis elegans Hypothetical p... 27 9.6 >AF100660-1|AAC68970.2| 442|Caenorhabditis elegans Hypothetical protein H35B03.1 protein. Length = 442 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -1 Query: 613 GSMCVGASVDLASSDFGVVASSFLASVEELVSLFLAASVW 494 G++ VG DL ++ FLA+VE+ +SLF+ W Sbjct: 36 GNIVVGVE-DLRDANLRFAVRYFLANVEKSISLFIVKQEW 74 >AF016450-13|AAB65988.2| 472|Caenorhabditis elegans Hypothetical protein B0238.9 protein. Length = 472 Score = 27.9 bits (59), Expect = 7.3 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -3 Query: 692 SYSQETKGQYDSTNKAWSIKCSCLYSWFY 606 S++ ET GQYD+ + C C++ Y Sbjct: 221 SFAGETNGQYDNNQEPHPSNCECVFHHDY 249 >Z93388-12|CAB07661.2| 294|Caenorhabditis elegans Hypothetical protein T10C6.4 protein. Length = 294 Score = 27.5 bits (58), Expect = 9.6 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -3 Query: 248 NCCCVFFRFTWSLRDIMRNGYCSSQL 171 NC FF+F W + RN C ++L Sbjct: 136 NCSFPFFQFGWVFMEAQRNETCGAKL 161 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,980,106 Number of Sequences: 27780 Number of extensions: 228713 Number of successful extensions: 756 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 712 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 756 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1592382278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -