BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11e03 (632 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07706.1 68415.m00956 expressed protein 30 1.1 At1g29680.1 68414.m03627 expressed protein 29 2.6 >At2g07706.1 68415.m00956 expressed protein Length = 306 Score = 30.3 bits (65), Expect = 1.1 Identities = 21/66 (31%), Positives = 32/66 (48%) Frame = -2 Query: 259 KIAKSGRRAHVLLLCYSNYSSLERK*STLISTCCACSSGSEVSSKGKPLVY*MNQNRKIL 80 KI SG V L +S+++SL LI T + S +V KG+PL+ + + + Sbjct: 60 KIHLSGSFQAVRLALFSSFTSLRTDELLLIETRPSYLSSVQVWGKGRPLLLLLTKREQPA 119 Query: 79 LSAKNE 62 L A E Sbjct: 120 LQANRE 125 >At1g29680.1 68414.m03627 expressed protein Length = 237 Score = 29.1 bits (62), Expect = 2.6 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = -3 Query: 426 MSMHFLIGSDTSPIVTNTRHAHKTQ*GSTECAESQSDRSNSDSIHITFII 277 +S + G D S ++ + H+ +CA SDRS++ I I ++I Sbjct: 43 VSTFAIYGGDMSRLIGTHHYVHRVNDEFLQCAVYASDRSDAPLIGIEYVI 92 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,343,769 Number of Sequences: 28952 Number of extensions: 225955 Number of successful extensions: 443 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 443 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1295224128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -