BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11d24 (651 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12979| Best HMM Match : GYF (HMM E-Value=8.6e-05) 84 1e-16 SB_48444| Best HMM Match : Death (HMM E-Value=2.1e-16) 29 2.5 SB_29019| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 >SB_12979| Best HMM Match : GYF (HMM E-Value=8.6e-05) Length = 341 Score = 83.8 bits (198), Expect = 1e-16 Identities = 34/72 (47%), Positives = 47/72 (65%) Frame = +2 Query: 326 NVMNSNDXXXXXXXXXXXXXXXXXXPFNMKEELEEGHFDTQGHYHWKKEKEIRDGWLDNI 505 N++++ D PFN+KEE+EEGHFD +G+YH KKEKEIRD WLD++ Sbjct: 51 NILSTEDIDGQEEATLDHDGEIKITPFNLKEEMEEGHFDNEGNYHLKKEKEIRDDWLDSV 110 Query: 506 DWVKVKGRPEDK 541 DWVK+K ++K Sbjct: 111 DWVKIKEMDKNK 122 >SB_48444| Best HMM Match : Death (HMM E-Value=2.1e-16) Length = 486 Score = 29.5 bits (63), Expect = 2.5 Identities = 16/45 (35%), Positives = 29/45 (64%) Frame = +2 Query: 122 NLVESDSLNLSSPIQEKAPKILLGYFTKMSKRPASEALIDEVKKA 256 N++ES ++ IQEKA ++LL + MSK+ +AL+D + ++ Sbjct: 159 NIIESIDVDYRR-IQEKAYQMLLAWQRTMSKKATVQALMDGLARS 202 >SB_29019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 646 Score = 28.7 bits (61), Expect = 4.3 Identities = 11/38 (28%), Positives = 25/38 (65%) Frame = +2 Query: 146 NLSSPIQEKAPKILLGYFTKMSKRPASEALIDEVKKAT 259 +LSS + +P +G+F ++ +RP+ +L D ++K++ Sbjct: 519 DLSSSSPDSSPNADVGFFGRLKRRPSLGSLTDIIQKSS 556 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,243,142 Number of Sequences: 59808 Number of extensions: 244848 Number of successful extensions: 677 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 677 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -