BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11d21 (559 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0343 + 12732673-12732792,12732903-12733091,12733220-127333... 45 4e-05 08_02_0955 + 22994266-22995630 31 0.62 04_04_1312 + 32565447-32565585,32566008-32566060,32566139-325667... 28 4.4 04_04_1311 - 32559549-32559674,32559761-32560078,32560158-325602... 28 4.4 01_01_0589 + 4394154-4394513,4394641-4394762,4394862-4395057,439... 27 7.7 >05_03_0343 + 12732673-12732792,12732903-12733091,12733220-12733387, 12733468-12733522,12733646-12733704,12734784-12734909, 12737281-12737409,12737486-12737540,12737633-12737808, 12737903-12737986,12738602-12738625 Length = 394 Score = 45.2 bits (102), Expect = 4e-05 Identities = 22/46 (47%), Positives = 30/46 (65%) Frame = +1 Query: 328 VLKLYNIVVDDVISGVRNSFLDDGVDEQVLQELKQLWKTKLQASGA 465 V +Y V+DDVIS VR+ F+ GV + VL EL+ LW+ K+ GA Sbjct: 6 VSTVYISVIDDVISKVRDDFISYGVGDAVLNELQALWEMKMLHCGA 51 >08_02_0955 + 22994266-22995630 Length = 454 Score = 31.1 bits (67), Expect = 0.62 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 5/70 (7%) Frame = +1 Query: 271 LLNNFQLQLDCKMTTSQLA--VLKL---YNIVVDDVISGVRNSFLDDGVDEQVLQELKQL 435 L N + QL K +T+QL+ V +L YN+++ V R+ L D +V + K++ Sbjct: 225 LHNMIRGQLSVKASTTQLSDKVRRLKHKYNLILTRVTKSGRDPDLPTEHDREVYELSKKV 284 Query: 436 WKTKLQASGA 465 W TK +GA Sbjct: 285 WGTKSGGAGA 294 >04_04_1312 + 32565447-32565585,32566008-32566060,32566139-32566771, 32566844-32566972,32567052-32567144,32567220-32567336, 32567412-32567512,32567603-32567870,32568236-32568265, 32568361-32568572,32568650-32568731,32568804-32569555, 32569640-32569811,32570412-32570498,32570578-32570895, 32570982-32571107 Length = 1103 Score = 28.3 bits (60), Expect = 4.4 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +2 Query: 143 KLCEFQKFDIEMLRCELRRQIIGSKLN*TDLETRIS 250 ++CE K +E +R E ++ KLN D E +IS Sbjct: 613 QICEINKDMVEKIRIETAVDLVNHKLNKRDEEEKIS 648 >04_04_1311 - 32559549-32559674,32559761-32560078,32560158-32560244, 32560845-32561016,32561101-32561852,32561925-32562006, 32562084-32562295,32562391-32562420,32562786-32563074, 32563143-32563243,32563319-32563435,32563511-32563603, 32563683-32563811,32563884-32564516,32564765-32564844, 32565152-32565164 Length = 1077 Score = 28.3 bits (60), Expect = 4.4 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +2 Query: 143 KLCEFQKFDIEMLRCELRRQIIGSKLN*TDLETRIS 250 ++CE K +E +R E ++ KLN D E +IS Sbjct: 587 QICEINKDMVEKIRIETAVDLVNHKLNKRDEEEKIS 622 >01_01_0589 + 4394154-4394513,4394641-4394762,4394862-4395057, 4395275-4395392,4395499-4395546,4395691-4395791, 4395893-4396000 Length = 350 Score = 27.5 bits (58), Expect = 7.7 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +1 Query: 361 VISGVRNSFLDDGVDEQVLQELKQLWKTKLQASGA 465 +ISG N +D E Q Q WKTK Q G+ Sbjct: 313 IISGHVNKNIDFEYQEYARQRFDQYWKTKDQTLGS 347 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,875,220 Number of Sequences: 37544 Number of extensions: 163638 Number of successful extensions: 345 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 341 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 345 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1269546012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -