BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11d21 (559 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47758| Best HMM Match : TFIIA (HMM E-Value=2.7e-18) 62 3e-10 SB_28844| Best HMM Match : SpoVT_AbrB (HMM E-Value=4.7) 30 1.1 >SB_47758| Best HMM Match : TFIIA (HMM E-Value=2.7e-18) Length = 296 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = +1 Query: 334 KLYNIVVDDVISGVRNSFLDDGVDEQVLQELKQLWKTKLQASGATD 471 KLY V++DVI V+ +FL++GVD+QVLQELKQ+W++KL S A D Sbjct: 19 KLYRNVIEDVIKNVKEAFLNEGVDDQVLQELKQIWESKLLQSRAVD 64 >SB_28844| Best HMM Match : SpoVT_AbrB (HMM E-Value=4.7) Length = 592 Score = 30.3 bits (65), Expect = 1.1 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +1 Query: 262 HFTLLNNFQLQLDCKMTTSQLAVLKLYNIVVDDVIS-GVRNSFLDDGVDEQVLQELKQL 435 H+ +L +F + C Q L L ++ +IS G +SF+ D DEQVL+ LK++ Sbjct: 112 HYMMLASFACRDTCFCQHHQNMALLLRSMKRKLLISTGNPDSFIKDNTDEQVLEILKKI 170 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,378,071 Number of Sequences: 59808 Number of extensions: 214421 Number of successful extensions: 451 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 451 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1300738331 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -