BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11d17 (570 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 24 3.0 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 23 7.0 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 24.2 bits (50), Expect = 3.0 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Frame = -1 Query: 318 CNGIFEFFH--ILHLSSHKLYNGFVVLNPFIRSSHKVFQVAKML*CRC 181 CN + + + IL L L F VL FI S +FQ A++L C C Sbjct: 30 CNPLSTYLYRTILALRLVTLLPCFNVLT-FISSFFSLFQTARVLTCYC 76 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 23.0 bits (47), Expect = 7.0 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +2 Query: 335 IIWTSKSRI*LHPVCCIITRLFCSIHV 415 IIWT+ + I +C I ++ C I + Sbjct: 31 IIWTTVTHILCAYLCYIFSKFACKIQI 57 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 557,034 Number of Sequences: 2352 Number of extensions: 11468 Number of successful extensions: 58 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53824896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -