BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11d16 (625 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1460 + 27295201-27295269,27295968-27296074,27296252-272963... 29 4.0 07_03_1285 + 25477542-25477625,25477776-25477832,25477973-254780... 28 5.2 11_04_0314 - 16277292-16277927,16278385-16278514,16278934-162792... 27 9.2 >08_02_1460 + 27295201-27295269,27295968-27296074,27296252-27296384, 27296621-27296714,27296828-27297030,27297167-27297240, 27297331-27297406,27297530-27297585,27297939-27298026, 27298115-27298255,27298338-27298487,27299015-27299221 Length = 465 Score = 28.7 bits (61), Expect = 4.0 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -1 Query: 469 YSLKYHKLQGYMF*ISYEHYCVVYNMYHPI 380 Y KY K+ G F IS YCV ++ Y+ + Sbjct: 224 YCTKYEKIVGEQFSISDAEYCVFHSPYNKL 253 >07_03_1285 + 25477542-25477625,25477776-25477832,25477973-25478040, 25478187-25478391,25478429-25478586,25478865-25478940, 25479065-25479124,25479186-25479236,25479663-25479741, 25480183-25480271 Length = 308 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 352 TWR*KSHCT*LGDTYCTLHNSVHMIFKTY 438 T+R + HC G T C H+S HM Y Sbjct: 24 TFRRRHHCRNCGRTLCHEHSSYHMALPQY 52 >11_04_0314 - 16277292-16277927,16278385-16278514,16278934-16279217, 16279308-16279431,16280442-16280530,16280630-16280706, 16280790-16280922,16282131-16282211,16282372-16282539 Length = 573 Score = 27.5 bits (58), Expect = 9.2 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 155 KTNILKTGCCLVCKNKICIDTKSAQIMRRFNLDNVTYAGCI 277 K +I+KT +V NK+ + I RF +D + +AGCI Sbjct: 283 KPHIMKTSSEIV--NKLRTEGHFMSIHLRFEMDMLAFAGCI 321 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,664,775 Number of Sequences: 37544 Number of extensions: 289847 Number of successful extensions: 524 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 517 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 524 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1513903616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -