BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11d16 (625 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF426157-1|ABO26400.1| 97|Anopheles gambiae unknown protein. 27 0.37 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 27 0.48 EF426160-1|ABO26403.1| 97|Anopheles gambiae unknown protein. 24 3.4 EF426159-1|ABO26402.1| 96|Anopheles gambiae unknown protein. 24 3.4 EF426158-1|ABO26401.1| 97|Anopheles gambiae unknown protein. 24 3.4 EF426156-1|ABO26399.1| 97|Anopheles gambiae unknown protein. 24 3.4 EF426155-1|ABO26398.1| 97|Anopheles gambiae unknown protein. 24 3.4 EF426154-1|ABO26397.1| 97|Anopheles gambiae unknown protein. 24 3.4 EF426153-1|ABO26396.1| 97|Anopheles gambiae unknown protein. 24 3.4 EF426152-1|ABO26395.1| 97|Anopheles gambiae unknown protein. 24 3.4 EF426151-1|ABO26394.1| 97|Anopheles gambiae unknown protein. 24 3.4 EF426150-1|ABO26393.1| 97|Anopheles gambiae unknown protein. 24 3.4 EF426149-1|ABO26392.1| 97|Anopheles gambiae unknown protein. 24 3.4 EF426148-1|ABO26391.1| 97|Anopheles gambiae unknown protein. 24 3.4 EF426147-1|ABO26390.1| 97|Anopheles gambiae unknown protein. 24 3.4 EF426146-1|ABO26389.1| 97|Anopheles gambiae unknown protein. 24 3.4 EF426145-1|ABO26388.1| 97|Anopheles gambiae unknown protein. 24 3.4 EF426144-1|ABO26387.1| 97|Anopheles gambiae unknown protein. 24 3.4 EF426143-1|ABO26386.1| 97|Anopheles gambiae unknown protein. 24 3.4 EF426142-1|ABO26385.1| 97|Anopheles gambiae unknown protein. 24 3.4 EF426141-1|ABO26384.1| 97|Anopheles gambiae unknown protein. 24 3.4 AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transpor... 24 4.5 AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-tran... 23 7.9 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 23 7.9 >EF426157-1|ABO26400.1| 97|Anopheles gambiae unknown protein. Length = 97 Score = 27.5 bits (58), Expect = 0.37 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = -1 Query: 163 VCFR--FWKPHFKYFPQLLTVVDALHNKFRCKYLEYATKICEY 41 +C R W +Y P+ L V DAL + +R K L C + Sbjct: 18 LCVRAMIWIKRLRYTPEPLRVEDALRDPYRVKVLRKVIDGCAF 60 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 27.1 bits (57), Expect = 0.48 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -1 Query: 109 VVDALHNKFRCKYLEYATKICEYC 38 +V+AL N+F CKY + +C C Sbjct: 724 LVEALPNQFLCKYDTHCFALCHCC 747 >EF426160-1|ABO26403.1| 97|Anopheles gambiae unknown protein. Length = 97 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 133 KYFPQLLTVVDALHNKFRCKYLEYATKICEY 41 +Y P+ L V DAL + +R K L C + Sbjct: 30 RYTPEPLRVEDALRDPYRVKVLRKVIDGCAF 60 >EF426159-1|ABO26402.1| 96|Anopheles gambiae unknown protein. Length = 96 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 133 KYFPQLLTVVDALHNKFRCKYLEYATKICEY 41 +Y P+ L V DAL + +R K L C + Sbjct: 29 RYTPEPLRVEDALRDPYRVKVLRKVIDGCAF 59 >EF426158-1|ABO26401.1| 97|Anopheles gambiae unknown protein. Length = 97 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 133 KYFPQLLTVVDALHNKFRCKYLEYATKICEY 41 +Y P+ L V DAL + +R K L C + Sbjct: 30 RYTPEPLRVEDALRDPYRVKVLRKVIDGCAF 60 >EF426156-1|ABO26399.1| 97|Anopheles gambiae unknown protein. Length = 97 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 133 KYFPQLLTVVDALHNKFRCKYLEYATKICEY 41 +Y P+ L V DAL + +R K L C + Sbjct: 30 RYTPEPLRVEDALRDPYRVKVLRKVIDGCAF 60 >EF426155-1|ABO26398.1| 97|Anopheles gambiae unknown protein. Length = 97 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 133 KYFPQLLTVVDALHNKFRCKYLEYATKICEY 41 +Y P+ L V DAL + +R K L C + Sbjct: 30 RYTPEPLRVEDALRDPYRVKVLRKVIDGCAF 60 >EF426154-1|ABO26397.1| 97|Anopheles gambiae unknown protein. Length = 97 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 133 KYFPQLLTVVDALHNKFRCKYLEYATKICEY 41 +Y P+ L V DAL + +R K L C + Sbjct: 30 RYTPEPLRVEDALRDPYRVKVLRKVIDGCAF 60 >EF426153-1|ABO26396.1| 97|Anopheles gambiae unknown protein. Length = 97 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 133 KYFPQLLTVVDALHNKFRCKYLEYATKICEY 41 +Y P+ L V DAL + +R K L C + Sbjct: 30 RYTPEPLRVEDALRDPYRVKVLRKVIDGCAF 60 >EF426152-1|ABO26395.1| 97|Anopheles gambiae unknown protein. Length = 97 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 133 KYFPQLLTVVDALHNKFRCKYLEYATKICEY 41 +Y P+ L V DAL + +R K L C + Sbjct: 30 RYTPEPLRVEDALRDPYRVKVLRKVIDGCAF 60 >EF426151-1|ABO26394.1| 97|Anopheles gambiae unknown protein. Length = 97 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 133 KYFPQLLTVVDALHNKFRCKYLEYATKICEY 41 +Y P+ L V DAL + +R K L C + Sbjct: 30 RYTPEPLRVEDALRDPYRVKVLRKVIDGCAF 60 >EF426150-1|ABO26393.1| 97|Anopheles gambiae unknown protein. Length = 97 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 133 KYFPQLLTVVDALHNKFRCKYLEYATKICEY 41 +Y P+ L V DAL + +R K L C + Sbjct: 30 RYTPEPLRVEDALRDPYRVKVLRKVIDGCAF 60 >EF426149-1|ABO26392.1| 97|Anopheles gambiae unknown protein. Length = 97 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 133 KYFPQLLTVVDALHNKFRCKYLEYATKICEY 41 +Y P+ L V DAL + +R K L C + Sbjct: 30 RYTPEPLRVEDALRDPYRVKVLRKVIDGCAF 60 >EF426148-1|ABO26391.1| 97|Anopheles gambiae unknown protein. Length = 97 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 133 KYFPQLLTVVDALHNKFRCKYLEYATKICEY 41 +Y P+ L V DAL + +R K L C + Sbjct: 30 RYTPEPLRVEDALRDPYRVKVLRKVIDGCAF 60 >EF426147-1|ABO26390.1| 97|Anopheles gambiae unknown protein. Length = 97 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 133 KYFPQLLTVVDALHNKFRCKYLEYATKICEY 41 +Y P+ L V DAL + +R K L C + Sbjct: 30 RYTPEPLRVEDALRDPYRVKVLRKVIDGCAF 60 >EF426146-1|ABO26389.1| 97|Anopheles gambiae unknown protein. Length = 97 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 133 KYFPQLLTVVDALHNKFRCKYLEYATKICEY 41 +Y P+ L V DAL + +R K L C + Sbjct: 30 RYTPEPLRVEDALRDPYRVKVLRKVIDGCAF 60 >EF426145-1|ABO26388.1| 97|Anopheles gambiae unknown protein. Length = 97 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 133 KYFPQLLTVVDALHNKFRCKYLEYATKICEY 41 +Y P+ L V DAL + +R K L C + Sbjct: 30 RYTPEPLRVEDALRDPYRVKVLRKVIDGCAF 60 >EF426144-1|ABO26387.1| 97|Anopheles gambiae unknown protein. Length = 97 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 133 KYFPQLLTVVDALHNKFRCKYLEYATKICEY 41 +Y P+ L V DAL + +R K L C + Sbjct: 30 RYTPEPLRVEDALRDPYRVKVLRKVIDGCAF 60 >EF426143-1|ABO26386.1| 97|Anopheles gambiae unknown protein. Length = 97 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 133 KYFPQLLTVVDALHNKFRCKYLEYATKICEY 41 +Y P+ L V DAL + +R K L C + Sbjct: 30 RYTPEPLRVEDALRDPYRVKVLRKVIDGCAF 60 >EF426142-1|ABO26385.1| 97|Anopheles gambiae unknown protein. Length = 97 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 133 KYFPQLLTVVDALHNKFRCKYLEYATKICEY 41 +Y P+ L V DAL + +R K L C + Sbjct: 30 RYTPEPLRVEDALRDPYRVKVLRKVIDGCAF 60 >EF426141-1|ABO26384.1| 97|Anopheles gambiae unknown protein. Length = 97 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 133 KYFPQLLTVVDALHNKFRCKYLEYATKICEY 41 +Y P+ L V DAL + +R K L C + Sbjct: 30 RYTPEPLRVEDALRDPYRVKVLRKVIDGCAF 60 >AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transporter protein. Length = 570 Score = 23.8 bits (49), Expect = 4.5 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -1 Query: 148 WKPHFKYFPQLLTV 107 W P FK FP LLT+ Sbjct: 241 WFPLFKLFPVLLTI 254 >AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-transferase e8 protein. Length = 217 Score = 23.0 bits (47), Expect = 7.9 Identities = 11/51 (21%), Positives = 24/51 (47%) Frame = +2 Query: 185 LVCKNKICIDTKSAQIMRRFNLDNVTYAGCITRSISKLMDSTKKFTVYETY 337 ++C N C+ + A++MR+ +T + I +D+ ++F Y Sbjct: 99 MLCFNNGCLFQRDAEVMRKIFSGAITDPTQHLKPIEAAIDALEQFLQRSRY 149 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 23.0 bits (47), Expect = 7.9 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -1 Query: 148 WKPHFKYFPQLLTVVDAL 95 W+P FKY+ L+++ A+ Sbjct: 602 WRPTFKYYNMWLSLLGAI 619 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 639,803 Number of Sequences: 2352 Number of extensions: 13886 Number of successful extensions: 34 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60632475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -