BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11d13 (640 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 24 1.2 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 23 2.1 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 23.8 bits (49), Expect = 1.2 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 481 TENMPQPIPGHLTNYKL 531 TE P P+PGH T+ L Sbjct: 320 TELYPSPVPGHSTSPNL 336 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 23.0 bits (47), Expect = 2.1 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +1 Query: 370 LRHPQILTVQHSLEESRESLAFATEPVFASLA 465 L HPQ+L S FA +P+F S++ Sbjct: 117 LYHPQVLLSPGGYSGSLCDQGFAQQPMFPSMS 148 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,642 Number of Sequences: 336 Number of extensions: 2904 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16501678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -