BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11d09 (568 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0077 + 3964729-3964734,3965194-3965289,3965744-3973579,397... 29 2.6 06_03_1283 - 28957729-28959258,28959354-28959550,28959824-289600... 29 2.6 02_02_0310 - 8842286-8843314 24 4.2 01_05_0200 - 19196606-19197304 25 4.4 11_04_0375 + 16933688-16933703,16936291-16937063 28 4.5 03_02_0599 - 9730204-9730314,9730766-9731549,9731631-9732051,973... 28 4.5 01_05_0267 - 20237001-20237802,20238257-20238386,20238679-20238820 23 5.2 12_01_0988 - 10039187-10039243,10039356-10039649,10039838-100402... 28 6.0 07_01_1173 + 11092482-11093465,11093552-11093914 28 6.0 06_03_0149 + 17260632-17260647,17263368-17264071 28 6.0 01_06_1067 + 34258036-34258051,34264808-34265679 28 6.0 07_03_0264 - 15958690-15958910,15959410-15959484,15959547-159597... 27 7.9 01_05_0197 + 19143582-19143618,19143814-19144523 27 7.9 12_01_0008 + 63393-64004 23 9.7 11_01_0009 + 67344-67955 23 9.7 >09_02_0077 + 3964729-3964734,3965194-3965289,3965744-3973579, 3973665-3973982,3974565-3974763,3974937-3975202, 3975288-3975574,3976714-3977818,3977900-3978046, 3978146-3978226,3978315-3978540,3978622-3978761, 3979539-3979645,3979739-3979841 Length = 3638 Score = 29.1 bits (62), Expect = 2.6 Identities = 11/41 (26%), Positives = 23/41 (56%) Frame = -3 Query: 236 PTLVFRSTPSCVNKSLYWSCNSSPELVDMMMMMTIQSPAKI 114 P+L+ ++ S +N S WS + EL+ ++ M+ +P + Sbjct: 276 PSLMQKAVDSIINGSTKWSTEFAEELLSLVSMLVSSTPGSL 316 >06_03_1283 - 28957729-28959258,28959354-28959550,28959824-28960026, 28960097-28960424,28960524-28960661,28960765-28961020, 28961529-28961626,28963104-28963367,28964395-28964584 Length = 1067 Score = 29.1 bits (62), Expect = 2.6 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = +3 Query: 396 TDPKR*HNIGLRESSG--AHHKNTPRRFKNVSHHP 494 T P + H+I + ESS HH N + ++ HHP Sbjct: 962 THPVQEHSISIEESSDHHEHHHNEEHKAEDCGHHP 996 >02_02_0310 - 8842286-8843314 Length = 342 Score = 23.8 bits (49), Expect(2) = 4.2 Identities = 18/74 (24%), Positives = 31/74 (41%), Gaps = 5/74 (6%) Frame = +3 Query: 135 RHHHHHVYE--FGR*ITRPVQRLVHARRGTSKDQCRSAGLRFQLNR--DALHCTERRRN* 302 RHHHHH + R P++R H + + R+ ++ D E R Sbjct: 226 RHHHHHHEDDHEQREEGAPMKRFRHHHEEEEESEMRTKRFHHHHHKDDDERELEEMARRW 285 Query: 303 MHR-METERLDHHR 341 + + + + R+ HHR Sbjct: 286 IRKALMSSRMHHHR 299 Score = 23.0 bits (47), Expect(2) = 4.2 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +3 Query: 132 YRHHHHH 152 +RHHHHH Sbjct: 191 HRHHHHH 197 >01_05_0200 - 19196606-19197304 Length = 232 Score = 24.6 bits (51), Expect(2) = 4.4 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 Query: 129 LYRHHHHH 152 LY HHHHH Sbjct: 219 LYHHHHHH 226 Score = 22.2 bits (45), Expect(2) = 4.4 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +3 Query: 138 HHHHHVYE 161 HHHHH Y+ Sbjct: 221 HHHHHHYK 228 >11_04_0375 + 16933688-16933703,16936291-16937063 Length = 262 Score = 28.3 bits (60), Expect = 4.5 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 259 SIGMLCIVQNADGTKCIEWRPNDLITI 339 ++G L +Q DG+ IEWR N LI + Sbjct: 6 ALGQLKAIQLLDGSNYIEWRNNVLINL 32 >03_02_0599 - 9730204-9730314,9730766-9731549,9731631-9732051, 9732139-9732385,9733730-9733921,9734071-9734204, 9734316-9734477,9736162-9736200,9737507-9737825 Length = 802 Score = 28.3 bits (60), Expect = 4.5 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +3 Query: 132 YRHHHHHVYEFGR*ITRPVQRLVHARRGTSKDQCRSAGL 248 + HHHHV+ + +T+ Q+ RG+S QC S+ + Sbjct: 634 FMQHHHHVHYYVHVMTQQ-QQQPSIERGSSDAQCGSSNV 671 >01_05_0267 - 20237001-20237802,20238257-20238386,20238679-20238820 Length = 357 Score = 22.6 bits (46), Expect(3) = 5.2 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +3 Query: 132 YRHHHHHVYE 161 + HHHHH +E Sbjct: 298 WHHHHHHHHE 307 Score = 21.4 bits (43), Expect(3) = 5.2 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +3 Query: 117 FSG*LYRHHHHH 152 FS + HHHHH Sbjct: 295 FSPWHHHHHHHH 306 Score = 20.6 bits (41), Expect(3) = 5.2 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 141 HHHHVYEFGR*ITRPVQRL 197 HHHH + + P QRL Sbjct: 299 HHHHHHHHEPTLPTPPQRL 317 >12_01_0988 - 10039187-10039243,10039356-10039649,10039838-10040202, 10042916-10042931 Length = 243 Score = 27.9 bits (59), Expect = 6.0 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 259 SIGMLCIVQNADGTKCIEWRPNDLITI 339 ++G L +Q DG+ +EWR N LI + Sbjct: 6 ALGQLKAIQLLDGSNYVEWRNNVLINL 32 >07_01_1173 + 11092482-11093465,11093552-11093914 Length = 448 Score = 27.9 bits (59), Expect = 6.0 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = +1 Query: 139 IIIIMSTSSGDELHDQYKDLFTQDGVLLKTSVGRPVSDFNSIGML 273 + + +S DE+ D+ +DL +DG LL+ +G V+ SI +L Sbjct: 213 LTVSVSLRRRDEVGDELQDLAVEDGPLLERLLGHDVNWGPSIHVL 257 >06_03_0149 + 17260632-17260647,17263368-17264071 Length = 239 Score = 27.9 bits (59), Expect = 6.0 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 259 SIGMLCIVQNADGTKCIEWRPNDLITI 339 ++G L +Q DG+ +EWR N LI + Sbjct: 6 ALGQLKAIQLLDGSNYVEWRNNVLINL 32 >01_06_1067 + 34258036-34258051,34264808-34265679 Length = 295 Score = 27.9 bits (59), Expect = 6.0 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 262 IGMLCIVQNADGTKCIEWRPNDLITI 339 +G L +Q DG+ +EWR N LI + Sbjct: 5 VGQLKAIQLLDGSNYVEWRNNVLINL 30 >07_03_0264 - 15958690-15958910,15959410-15959484,15959547-15959775, 15960312-15960587,15962109-15962369,15962632-15962781, 15963555-15963591,15963958-15964024,15964228-15964291, 15964643-15964812,15965046-15965124,15965576-15965733, 15965862-15966030,15966531-15966602,15966977-15967018, 15967245-15967488,15968782-15968963 Length = 831 Score = 27.5 bits (58), Expect = 7.9 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 120 SG*LYRHHHHHVYEFGR*ITRPVQ 191 +G L RHHHHH + G + R +Q Sbjct: 17 AGHLCRHHHHHHHRDGLVLARSLQ 40 >01_05_0197 + 19143582-19143618,19143814-19144523 Length = 248 Score = 27.5 bits (58), Expect = 7.9 Identities = 17/63 (26%), Positives = 26/63 (41%), Gaps = 4/63 (6%) Frame = +1 Query: 259 SIGMLCIVQNADGTKCIEWRPNDLITI----DSDTQDQEWAVVNTVGRRQRTLSGNITSD 426 ++G L +Q DG+ +EWR N I + D + Q +N +G L Sbjct: 13 ALGQLKAIQLLDGSNYVEWRNNVFINLAIREDPPEEPQPAEELNIIGEEYDNLMWAYNKK 72 Query: 427 YAN 435 AN Sbjct: 73 LAN 75 >12_01_0008 + 63393-64004 Length = 203 Score = 23.0 bits (47), Expect(2) = 9.7 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +3 Query: 132 YRHHHHHVY 158 + HHHHH Y Sbjct: 111 HHHHHHHPY 119 Score = 22.6 bits (46), Expect(2) = 9.7 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +3 Query: 129 LYRHHHHH 152 L+ HHHHH Sbjct: 109 LHHHHHHH 116 >11_01_0009 + 67344-67955 Length = 203 Score = 23.0 bits (47), Expect(2) = 9.7 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +3 Query: 132 YRHHHHHVY 158 + HHHHH Y Sbjct: 111 HHHHHHHPY 119 Score = 22.6 bits (46), Expect(2) = 9.7 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +3 Query: 129 LYRHHHHH 152 L+ HHHHH Sbjct: 109 LHHHHHHH 116 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,255,220 Number of Sequences: 37544 Number of extensions: 320716 Number of successful extensions: 983 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 861 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 963 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1305140760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -