BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11d06 (555 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_973| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.63 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_32463| Best HMM Match : Flocculin (HMM E-Value=6.8) 29 2.6 SB_10694| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_33614| Best HMM Match : Ribosomal_S12 (HMM E-Value=6.8) 29 3.4 SB_12669| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_982| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 SB_5019| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 >SB_973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1200 Score = 31.1 bits (67), Expect = 0.63 Identities = 26/84 (30%), Positives = 32/84 (38%) Frame = +3 Query: 129 VSIASRIRRDRDGFTSREPARLPPDTVPHQLDQQPEQPLEYSAESDAGNTAVFWLHSAAA 308 V +R R+ T R P PP P +D + P E S+ESD+GN Sbjct: 260 VRAQTRQHRNESDPTQRSPRSSPP---PFTIDVVIDTPNESSSESDSGNRNTQPTRRPLR 316 Query: 309 LRNADGSGERPLPVHQCVDFAVSF 380 G G RP H A SF Sbjct: 317 RLGTTGYGPRPGVGHSVSLPAASF 340 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +1 Query: 58 RSILLCFAVLLVERADAMIPAYSVSALRLAFDEIATVLPVANQL 189 RS+ C V+L+ A + A +VS LAF+ T++P N++ Sbjct: 2005 RSLAACQGVVLLVDAAQGVQAQTVSNFFLAFNSELTIIPALNKI 2048 >SB_32463| Best HMM Match : Flocculin (HMM E-Value=6.8) Length = 107 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = -2 Query: 182 FATGKTVAISSNARRNADTEYAGIIASARSTNNTAKHNKI 63 + G + SN T+ ++ A S NNTAK N++ Sbjct: 61 YCNGGLELVESNHSNGPTTDMTSCVSMAESNNNTAKENEL 100 >SB_10694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.1 bits (62), Expect = 2.6 Identities = 14/54 (25%), Positives = 29/54 (53%) Frame = +1 Query: 25 YSALVFF*IMIRSILLCFAVLLVERADAMIPAYSVSALRLAFDEIATVLPVANQ 186 + ++ F + + LL +++ +RA MIPA+ +AF+ + T L A++ Sbjct: 31 FMSVTFLRAPLTTPLLIETIVVFQRAVTMIPAHDSPVASMAFNHMGTKLATASE 84 >SB_33614| Best HMM Match : Ribosomal_S12 (HMM E-Value=6.8) Length = 201 Score = 28.7 bits (61), Expect = 3.4 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 3/73 (4%) Frame = +3 Query: 135 IASRIRRDRDGFTSREPARLPPDTVPHQLDQQPEQPLE---YSAESDAGNTAVFWLHSAA 305 I +R + D G+ P R PD ++ ++ E+PL +S S T+ W+ Sbjct: 18 IGNRTKPDCPGYQGF-PHRRRPDNATNECRRKAEKPLAPRTFSIFSRKRQTSNLWVSRGK 76 Query: 306 ALRNADGSGERPL 344 ALR++ S R L Sbjct: 77 ALRSSSQSAVRVL 89 >SB_12669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 28.3 bits (60), Expect = 4.5 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 375 KQRNQHTDVQEEDARQIRQRCVKQRQSATK 286 K R +HT Q+ED ++ RQ+ +K+R + K Sbjct: 283 KSRIEHTQKQKEDRQKQRQKNLKERSLSKK 312 >SB_982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 27.5 bits (58), Expect = 7.8 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +3 Query: 180 EPARLPPDTVPHQLDQQPEQPLEYSAESDAGNTA 281 EP+ PP VP Q ++P P S ES++ +++ Sbjct: 277 EPSS-PPRLVPRQRSKEPSSPARSSVESNSSSSS 309 >SB_5019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1616 Score = 27.5 bits (58), Expect = 7.8 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 108 DDTGVLRVSIASRIRRDRDGFTSREPARLPPD 203 DD G++RV R+RR G+ R P LP D Sbjct: 1172 DDQGLIRVG--GRLRRADLGYIERHPVLLPND 1201 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,858,660 Number of Sequences: 59808 Number of extensions: 200205 Number of successful extensions: 678 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 675 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1288581898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -