BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11c23 (361 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014298-2248|AAN09369.1| 57|Drosophila melanogaster CG9032-PB... 89 1e-18 AY071744-1|AAL49366.1| 61|Drosophila melanogaster RH48911p pro... 87 5e-18 AY071158-1|AAL48780.1| 61|Drosophila melanogaster RE19513p pro... 87 5e-18 AE014298-2247|AAF48526.1| 61|Drosophila melanogaster CG9032-PA... 87 5e-18 AE014297-1096|AAF54496.1| 64|Drosophila melanogaster CG31477-P... 78 4e-15 AY437926-1|AAR24077.1| 924|Drosophila melanogaster AMO protein. 29 2.4 AY283154-1|AAQ18122.1| 924|Drosophila melanogaster polycystin-2... 29 2.4 AE014134-2193|AAF53183.2| 924|Drosophila melanogaster CG6504-PA... 29 2.4 AY349650-1|AAQ64933.1| 1028|Drosophila melanogaster Toll protein. 28 4.1 M19969-1|AAA28941.1| 1097|Drosophila melanogaster protein ( Dros... 27 9.5 AY349655-1|AAQ64938.1| 1028|Drosophila melanogaster Toll protein. 27 9.5 AY349654-1|AAQ64937.1| 1028|Drosophila melanogaster Toll protein. 27 9.5 AY349653-1|AAQ64936.1| 1028|Drosophila melanogaster Toll protein. 27 9.5 AY349652-1|AAQ64935.1| 1028|Drosophila melanogaster Toll protein. 27 9.5 AY349651-1|AAQ64934.1| 1028|Drosophila melanogaster Toll protein. 27 9.5 AY349649-1|AAQ64932.1| 1028|Drosophila melanogaster Toll protein. 27 9.5 AE014297-3998|AAN14086.1| 1097|Drosophila melanogaster CG5490-PB... 27 9.5 AE014297-3997|AAF56624.1| 1097|Drosophila melanogaster CG5490-PA... 27 9.5 >AE014298-2248|AAN09369.1| 57|Drosophila melanogaster CG9032-PB, isoform B protein. Length = 57 Score = 89.4 bits (212), Expect = 1e-18 Identities = 38/54 (70%), Positives = 45/54 (83%) Frame = +3 Query: 87 MSAWRQAGLTYINYSNIAAKVLRRSLKQEFRAEALKRDESHVRVTPWANGRPAH 248 M+AWR AG+TYI YSNIAA++LR SLK RA+A KRD SHV+ TPWANG+PAH Sbjct: 1 MTAWRAAGITYIQYSNIAARILRESLKTGLRADAAKRDASHVKFTPWANGKPAH 54 >AY071744-1|AAL49366.1| 61|Drosophila melanogaster RH48911p protein. Length = 61 Score = 87.4 bits (207), Expect = 5e-18 Identities = 38/56 (67%), Positives = 45/56 (80%) Frame = +3 Query: 87 MSAWRQAGLTYINYSNIAAKVLRRSLKQEFRAEALKRDESHVRVTPWANGRPAHLQ 254 M+AWR AG+TYI YSNIAA++LR SLK RA+A KRD SHV+ TPWANG+PA Q Sbjct: 1 MTAWRAAGITYIQYSNIAARILRESLKTGLRADAAKRDASHVKFTPWANGKPAQRQ 56 >AY071158-1|AAL48780.1| 61|Drosophila melanogaster RE19513p protein. Length = 61 Score = 87.4 bits (207), Expect = 5e-18 Identities = 38/56 (67%), Positives = 45/56 (80%) Frame = +3 Query: 87 MSAWRQAGLTYINYSNIAAKVLRRSLKQEFRAEALKRDESHVRVTPWANGRPAHLQ 254 M+AWR AG+TYI YSNIAA++LR SLK RA+A KRD SHV+ TPWANG+PA Q Sbjct: 1 MTAWRAAGITYIQYSNIAARILRESLKTGLRADAAKRDASHVKFTPWANGKPAQRQ 56 >AE014298-2247|AAF48526.1| 61|Drosophila melanogaster CG9032-PA, isoform A protein. Length = 61 Score = 87.4 bits (207), Expect = 5e-18 Identities = 38/56 (67%), Positives = 45/56 (80%) Frame = +3 Query: 87 MSAWRQAGLTYINYSNIAAKVLRRSLKQEFRAEALKRDESHVRVTPWANGRPAHLQ 254 M+AWR AG+TYI YSNIAA++LR SLK RA+A KRD SHV+ TPWANG+PA Q Sbjct: 1 MTAWRAAGITYIQYSNIAARILRESLKTGLRADAAKRDASHVKFTPWANGKPAQRQ 56 >AE014297-1096|AAF54496.1| 64|Drosophila melanogaster CG31477-PA protein. Length = 64 Score = 77.8 bits (183), Expect = 4e-15 Identities = 33/57 (57%), Positives = 43/57 (75%) Frame = +3 Query: 87 MSAWRQAGLTYINYSNIAAKVLRRSLKQEFRAEALKRDESHVRVTPWANGRPAHLQK 257 M AWR G+TYI YSNIAA+V+R +L+ E RA+A KR+ SHV+ TPW NG+P +K Sbjct: 1 MKAWRDLGITYIQYSNIAARVVREALRIELRADAAKRNISHVKFTPWVNGKPVPRKK 57 >AY437926-1|AAR24077.1| 924|Drosophila melanogaster AMO protein. Length = 924 Score = 28.7 bits (61), Expect = 2.4 Identities = 15/55 (27%), Positives = 29/55 (52%) Frame = -3 Query: 344 VIYCTILHKLIVDDFHACWLTIPSSLWNSFLEVCRSSVGPRCDSDVRFVTFQRLC 180 + +C++L+ L C+L + ++W+SF + S+ R SDV + + LC Sbjct: 617 IYFCSMLNILDCAILLGCYLALVYNIWHSFKVM---SLTARAHSDVTYQSLDVLC 668 >AY283154-1|AAQ18122.1| 924|Drosophila melanogaster polycystin-2 protein. Length = 924 Score = 28.7 bits (61), Expect = 2.4 Identities = 15/55 (27%), Positives = 29/55 (52%) Frame = -3 Query: 344 VIYCTILHKLIVDDFHACWLTIPSSLWNSFLEVCRSSVGPRCDSDVRFVTFQRLC 180 + +C++L+ L C+L + ++W+SF + S+ R SDV + + LC Sbjct: 617 IYFCSMLNILDCAILLGCYLALVYNIWHSFKVM---SLTARAHSDVTYQSLDVLC 668 >AE014134-2193|AAF53183.2| 924|Drosophila melanogaster CG6504-PA protein. Length = 924 Score = 28.7 bits (61), Expect = 2.4 Identities = 15/55 (27%), Positives = 29/55 (52%) Frame = -3 Query: 344 VIYCTILHKLIVDDFHACWLTIPSSLWNSFLEVCRSSVGPRCDSDVRFVTFQRLC 180 + +C++L+ L C+L + ++W+SF + S+ R SDV + + LC Sbjct: 617 IYFCSMLNILDCAILLGCYLALVYNIWHSFKVM---SLTARAHSDVTYQSLDVLC 668 >AY349650-1|AAQ64933.1| 1028|Drosophila melanogaster Toll protein. Length = 1028 Score = 27.9 bits (59), Expect = 4.1 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +2 Query: 107 WFN-LHKLLKHRSQGASQVTKARISSRGVE 193 W N LH L KH +GAS V I G+E Sbjct: 160 WSNQLHNLTKHDFEGASSVLGIDIHDNGIE 189 >M19969-1|AAA28941.1| 1097|Drosophila melanogaster protein ( Drosophila melanogastertoll mRNA required for dorsal-ventral embryonic polarity,complete cds. ). Length = 1097 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +2 Query: 107 WFN-LHKLLKHRSQGASQVTKARISSRGVE 193 W N LH L KH +GA+ V I G+E Sbjct: 229 WSNQLHNLTKHDFEGATSVLGIDIHDNGIE 258 >AY349655-1|AAQ64938.1| 1028|Drosophila melanogaster Toll protein. Length = 1028 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +2 Query: 107 WFN-LHKLLKHRSQGASQVTKARISSRGVE 193 W N LH L KH +GA+ V I G+E Sbjct: 160 WSNQLHNLTKHDFEGATSVLGIDIHDNGIE 189 >AY349654-1|AAQ64937.1| 1028|Drosophila melanogaster Toll protein. Length = 1028 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +2 Query: 107 WFN-LHKLLKHRSQGASQVTKARISSRGVE 193 W N LH L KH +GA+ V I G+E Sbjct: 160 WSNQLHNLTKHDFEGATSVLGIDIHDNGIE 189 >AY349653-1|AAQ64936.1| 1028|Drosophila melanogaster Toll protein. Length = 1028 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +2 Query: 107 WFN-LHKLLKHRSQGASQVTKARISSRGVE 193 W N LH L KH +GA+ V I G+E Sbjct: 160 WSNQLHNLTKHDFEGATSVLGIDIHDNGIE 189 >AY349652-1|AAQ64935.1| 1028|Drosophila melanogaster Toll protein. Length = 1028 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +2 Query: 107 WFN-LHKLLKHRSQGASQVTKARISSRGVE 193 W N LH L KH +GA+ V I G+E Sbjct: 160 WSNQLHNLTKHDFEGATSVLGIDIHDNGIE 189 >AY349651-1|AAQ64934.1| 1028|Drosophila melanogaster Toll protein. Length = 1028 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +2 Query: 107 WFN-LHKLLKHRSQGASQVTKARISSRGVE 193 W N LH L KH +GA+ V I G+E Sbjct: 160 WSNQLHNLTKHDFEGATSVLGIDIHDNGIE 189 >AY349649-1|AAQ64932.1| 1028|Drosophila melanogaster Toll protein. Length = 1028 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +2 Query: 107 WFN-LHKLLKHRSQGASQVTKARISSRGVE 193 W N LH L KH +GA+ V I G+E Sbjct: 160 WSNQLHNLTKHDFEGATSVLGIDIHDNGIE 189 >AE014297-3998|AAN14086.1| 1097|Drosophila melanogaster CG5490-PB, isoform B protein. Length = 1097 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +2 Query: 107 WFN-LHKLLKHRSQGASQVTKARISSRGVE 193 W N LH L KH +GA+ V I G+E Sbjct: 229 WSNQLHNLTKHDFEGATSVLGIDIHDNGIE 258 >AE014297-3997|AAF56624.1| 1097|Drosophila melanogaster CG5490-PA, isoform A protein. Length = 1097 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +2 Query: 107 WFN-LHKLLKHRSQGASQVTKARISSRGVE 193 W N LH L KH +GA+ V I G+E Sbjct: 229 WSNQLHNLTKHDFEGATSVLGIDIHDNGIE 258 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,692,354 Number of Sequences: 53049 Number of extensions: 293719 Number of successful extensions: 662 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 662 length of database: 24,988,368 effective HSP length: 76 effective length of database: 20,956,644 effective search space used: 901135692 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -