BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11c23 (361 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 23 0.83 DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 21 3.3 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 21 3.3 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 5.9 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 20 7.7 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 20 7.7 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 20 7.7 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 20 7.7 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 20 7.7 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 23.4 bits (48), Expect = 0.83 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 2 IFHFTLWLWKSGKFQFIFENKSKQEQ*QNER 94 +F+ T W + G+ QF F KQ+ N R Sbjct: 174 VFNGTGWTFHEGRKQFYFHQFYKQQPDLNYR 204 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 21.4 bits (43), Expect = 3.3 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 335 CTILHKLIVDDFHACWLTIPSSLWNSFLEV 246 CT + K +D + T WN F+E+ Sbjct: 78 CTEIQKQNLDKLAEWFTTNEPEKWNHFVEI 107 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 21.4 bits (43), Expect = 3.3 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -3 Query: 335 CTILHKLIVDDFHACWLTIPSSLWNSFLEV 246 CT + K +D + T WN F+E+ Sbjct: 78 CTEIQKQNLDKLAEWFTTNEPEKWNHFVEI 107 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 20.6 bits (41), Expect = 5.9 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 92 AHFVIVLVYFYSQK*IEIFLI 30 A + ++LVYF+ Q+ + FLI Sbjct: 198 AEYSMLLVYFHLQRHMGNFLI 218 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.2 bits (40), Expect = 7.7 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +3 Query: 63 KVNKNNNKMSAWRQAGLTYINYSN 134 K+ NNN +S Y NY+N Sbjct: 80 KIISNNNSLSNNYNYNNNYNNYNN 103 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.2 bits (40), Expect = 7.7 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +3 Query: 60 IKVNKNNNKMSAWRQAGLTY 119 + VNK+ NK + W++ Y Sbjct: 690 VSVNKSWNKWNDWQETQNNY 709 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.2 bits (40), Expect = 7.7 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +3 Query: 60 IKVNKNNNKMSAWRQAGLTY 119 + VNK+ NK + W++ Y Sbjct: 690 VSVNKSWNKWNDWQETQNNY 709 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.2 bits (40), Expect = 7.7 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +3 Query: 60 IKVNKNNNKMSAWRQAGLTY 119 + VNK+ NK + W++ Y Sbjct: 690 VSVNKSWNKWNDWQETQNNY 709 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 20.2 bits (40), Expect = 7.7 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 281 IPSSLWNSFLEVCRS 237 I SL FL+VCRS Sbjct: 334 IRESLDTQFLQVCRS 348 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,322 Number of Sequences: 438 Number of extensions: 1699 Number of successful extensions: 10 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8432340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -