BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11c21 (698 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 49 1e-07 AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical prot... 24 5.3 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 9.2 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 49.2 bits (112), Expect = 1e-07 Identities = 24/63 (38%), Positives = 35/63 (55%) Frame = +2 Query: 467 ITVIGQDIPSPFVDIEASGFPEYIKTFLKMQGITKPTVIQSQGWPIALSGKNFVGIAQTG 646 + V G++ P E SG E + T ++ TKPT IQ PI L+G++ + AQTG Sbjct: 162 VRVSGENPPDHVESFERSGLREEVMTNVRKSSYTKPTPIQRYAIPIILNGRDLMACAQTG 221 Query: 647 TGK 655 +GK Sbjct: 222 SGK 224 >AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical protein protein. Length = 257 Score = 23.8 bits (49), Expect = 5.3 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -2 Query: 529 RKSTGFYVNKRTGYILTNNSNAIIT 455 R TG +V R TNN+N IIT Sbjct: 198 RGETGNWVQHRAQRNRTNNNNTIIT 222 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.0 bits (47), Expect = 9.2 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 615 PLKAIGHPCDCITVGFVIPCIFRNVFI 535 P + GH CD + F+ + R +FI Sbjct: 367 PKLSQGHKCDVVAATFLDVAVLRCLFI 393 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 737,035 Number of Sequences: 2352 Number of extensions: 15545 Number of successful extensions: 24 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -