BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11c10 (528 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. 27 0.39 AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. 27 0.39 AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. 27 0.39 AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. 27 0.39 Z32645-2|CAA83568.1| 259|Anopheles gambiae chymotrypsin-like pr... 27 0.51 Z22930-2|CAA80514.1| 274|Anopheles gambiae trypsin-related prot... 27 0.51 Z18887-1|CAA79325.1| 259|Anopheles gambiae chymotrypsin 1 protein. 27 0.51 Z22930-1|CAA80513.1| 273|Anopheles gambiae trypsin-related prot... 26 0.68 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 4.8 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 6.3 AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant r... 23 8.4 AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transpo... 23 8.4 AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein p... 23 8.4 >AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. Length = 285 Score = 27.1 bits (57), Expect = 0.39 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -2 Query: 386 NPWSDTVAWCLGYHRLVDDP 327 NPWS + + +G+HR++ P Sbjct: 27 NPWSRELEFVIGHHRILQGP 46 >AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. Length = 285 Score = 27.1 bits (57), Expect = 0.39 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -2 Query: 386 NPWSDTVAWCLGYHRLVDDP 327 NPWS + + +G+HR++ P Sbjct: 27 NPWSRELEFVIGHHRILQGP 46 >AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. Length = 285 Score = 27.1 bits (57), Expect = 0.39 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -2 Query: 386 NPWSDTVAWCLGYHRLVDDP 327 NPWS + + +G+HR++ P Sbjct: 27 NPWSRELEFVIGHHRILQGP 46 >AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. Length = 285 Score = 27.1 bits (57), Expect = 0.39 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -2 Query: 386 NPWSDTVAWCLGYHRLVDDP 327 NPWS + + +G+HR++ P Sbjct: 27 NPWSRELEFVIGHHRILQGP 46 >Z32645-2|CAA83568.1| 259|Anopheles gambiae chymotrypsin-like protease ANCHYM1 protein. Length = 259 Score = 26.6 bits (56), Expect = 0.51 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -3 Query: 526 TGDANCKANSGPPFVFCSKLQMIINW 449 TG+ C +SG P V+ KL ++N+ Sbjct: 203 TGEGACNGDSGGPLVYEGKLVGVVNF 228 >Z22930-2|CAA80514.1| 274|Anopheles gambiae trypsin-related protease protein. Length = 274 Score = 26.6 bits (56), Expect = 0.51 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 523 GDANCKANSGPPFVFCSKLQMIINW 449 G C+ +SG PFV KL +I+W Sbjct: 221 GQDTCRQDSGGPFVAEGKLIGVISW 245 >Z18887-1|CAA79325.1| 259|Anopheles gambiae chymotrypsin 1 protein. Length = 259 Score = 26.6 bits (56), Expect = 0.51 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -3 Query: 526 TGDANCKANSGPPFVFCSKLQMIINW 449 TG+ C +SG P V+ KL ++N+ Sbjct: 203 TGEGACNGDSGGPLVYEGKLVGVVNF 228 >Z22930-1|CAA80513.1| 273|Anopheles gambiae trypsin-related protease protein. Length = 273 Score = 26.2 bits (55), Expect = 0.68 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 523 GDANCKANSGPPFVFCSKLQMIINW 449 G C+ +SG PFV KL +++W Sbjct: 220 GTGTCRNDSGGPFVAEGKLIGVVSW 244 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.4 bits (48), Expect = 4.8 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = +3 Query: 390 SATIITDCTPTVCKNLANTIQLMI 461 S ++ITDC + C+ L+N ++ + Sbjct: 38 SQSVITDCDTSKCQPLSNISEVSL 61 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 23.0 bits (47), Expect = 6.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 398 DNYGLHSDRLQELGQHNPVNDHL 466 D Y L +RL GQ+NP+ L Sbjct: 1124 DLYVLQPERLNSSGQNNPLKGKL 1146 >AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant receptor Or5 protein. Length = 391 Score = 22.6 bits (46), Expect = 8.4 Identities = 7/25 (28%), Positives = 16/25 (64%) Frame = -3 Query: 469 LQMIINWIVLAKFLQTVGVQSVIIV 395 L++I W+ L +F+Q V + +++ Sbjct: 259 LEIIFRWVFLGQFIQCVMIWCSLVL 283 >AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transporter Ag_AAT8 protein. Length = 636 Score = 22.6 bits (46), Expect = 8.4 Identities = 10/43 (23%), Positives = 18/43 (41%) Frame = -2 Query: 320 FVYPRGFYHSRALDEPRALNEPRTLDEPGTIVESRALEDPWSV 192 F+YP + H R+ +P ++ P +R L W + Sbjct: 190 FMYPLPWAHCRSEWQPNCIDSLAGSASPNDSSSNRTLTSSWEL 232 >AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein protein. Length = 357 Score = 22.6 bits (46), Expect = 8.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -2 Query: 281 DEPRALNEPRTLDEPGTIVESRA 213 D+P A P T + PG +V + A Sbjct: 262 DDPAAAAAPATAEVPGAVVANPA 284 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 557,287 Number of Sequences: 2352 Number of extensions: 11764 Number of successful extensions: 23 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 48628785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -