BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11c10 (528 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 24 0.84 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 24 0.84 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 4.5 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 4.5 AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 22 4.5 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 24.2 bits (50), Expect = 0.84 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = -2 Query: 386 NPWSDTVAWCLGYHRLVDDP 327 NPW+ + + +G HR++ P Sbjct: 396 NPWTKKLEFVVGQHRILKGP 415 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 24.2 bits (50), Expect = 0.84 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = -2 Query: 386 NPWSDTVAWCLGYHRLVDDP 327 NPW+ + + +G HR++ P Sbjct: 102 NPWTKKLEFVVGQHRILKGP 121 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.8 bits (44), Expect = 4.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 201 RIFEGPRFYDSPRLIESP 254 RIF GP++ +LIE P Sbjct: 517 RIFIGPKYDSHHKLIEIP 534 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.8 bits (44), Expect = 4.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 201 RIFEGPRFYDSPRLIESP 254 RIF GP++ +LIE P Sbjct: 517 RIFIGPKYDSHHKLIEIP 534 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 21.8 bits (44), Expect = 4.5 Identities = 10/39 (25%), Positives = 18/39 (46%) Frame = -2 Query: 314 YPRGFYHSRALDEPRALNEPRTLDEPGTIVESRALEDPW 198 YP + + + +N+ T++ I S AL+ PW Sbjct: 131 YPSPEWDTVTPEAKNLINQMLTVNPSKRITASEALKHPW 169 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,498 Number of Sequences: 438 Number of extensions: 3306 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14845611 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -