BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11c09 (633 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) 31 0.78 SB_6010| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_12805| Best HMM Match : LicD (HMM E-Value=9.7e-06) 29 2.4 SB_28816| Best HMM Match : PAS (HMM E-Value=0.0047) 29 4.1 SB_1181| Best HMM Match : DUF1604 (HMM E-Value=0) 28 5.5 SB_51159| Best HMM Match : DUF1140 (HMM E-Value=2.3) 28 7.2 SB_41830| Best HMM Match : S4 (HMM E-Value=1.6e-12) 28 7.2 SB_18760| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_56786| Best HMM Match : Brevenin (HMM E-Value=1.5) 27 9.6 >SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) Length = 210 Score = 31.1 bits (67), Expect = 0.78 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = +2 Query: 347 IFVQGSQEAKEDDHDVFASQFFHTYSLPVNSSAADVTAELTSDGYLVVTA 496 I + G ++ E +H S+F +Y+LP + V++ +T DG L + A Sbjct: 64 IKIDGKHKS-EGEHGYETSEFHRSYNLPDGVDVSTVSSRITGDGLLHIEA 112 >SB_6010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = +3 Query: 471 PMDTSS*RRRSAKMLIKRKNTERVVPIVETGAPYKKDEPVEKTTVETL 614 PM T ++ IKR N + V+ +V+TG +K+ E + TV L Sbjct: 903 PMTTHRLTNDTSDYEIKRVNGKEVIRLVDTGIRFKQSERQQSLTVVNL 950 >SB_12805| Best HMM Match : LicD (HMM E-Value=9.7e-06) Length = 371 Score = 29.5 bits (63), Expect = 2.4 Identities = 20/62 (32%), Positives = 26/62 (41%) Frame = -1 Query: 258 ILGPMSTKVGISFHKGANRLNGERFSHGNVNWSSVMETGCAITSLSRAGKAVTVAKPAKA 79 I+GP+ K G F R G F NW V+ T T +S A + V +PA Sbjct: 217 IMGPLWFKHGDIFPVARLRFEGFMFDVPR-NWKQVLRTLYGRTGISAAVPTLMVVEPAPT 275 Query: 78 MK 73 K Sbjct: 276 QK 277 >SB_28816| Best HMM Match : PAS (HMM E-Value=0.0047) Length = 405 Score = 28.7 bits (61), Expect = 4.1 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = -3 Query: 265 SVDSWPDVHKSGDQLPQRSKQTEWRKVQPWEREL--VICNGDGLRD 134 +V S+ + KSG +P R++ T +R PW +E+ ++C D L + Sbjct: 135 AVSSYRFLCKSGHYIPLRTRSTLFR--NPWTKEIEFLVCTNDVLTE 178 >SB_1181| Best HMM Match : DUF1604 (HMM E-Value=0) Length = 1035 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 359 GSQEAKEDDHDVFASQFFHTYSLPVNSSAA 448 G+ +E+D DV+A Y +P N SAA Sbjct: 245 GTGVFEEEDDDVYAQDIMSNYDIPKNISAA 274 >SB_51159| Best HMM Match : DUF1140 (HMM E-Value=2.3) Length = 444 Score = 27.9 bits (59), Expect = 7.2 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +2 Query: 137 AQPVSITDDQFTFPWLNLSPFSLFAPLWKLIPTFVDIGP 253 + P + T DQ + + + SPFS APL P FVD P Sbjct: 219 SSPETFTSDQLSPTYSSPSPFSSKAPL----PVFVDFTP 253 >SB_41830| Best HMM Match : S4 (HMM E-Value=1.6e-12) Length = 275 Score = 27.9 bits (59), Expect = 7.2 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -1 Query: 258 ILGPMSTKVGISFHKGANRLNGERFSH 178 + G T+VGI H G NR+ + F H Sbjct: 209 VAGEKKTEVGIKIHSGRNRIVRKIFEH 235 >SB_18760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1569 Score = 27.5 bits (58), Expect = 9.6 Identities = 13/43 (30%), Positives = 28/43 (65%), Gaps = 3/43 (6%) Frame = +3 Query: 495 RRSAKMLIKRKNTERVVPIVETG---APYKKDEPVEKTTVETL 614 RR ++ + + N + +V ++E+G PY++++P+ +TTV L Sbjct: 316 RRLSRRRVTKLNNKNLV-LIESGMIEVPYQREKPLHETTVMAL 357 >SB_56786| Best HMM Match : Brevenin (HMM E-Value=1.5) Length = 193 Score = 27.5 bits (58), Expect = 9.6 Identities = 16/59 (27%), Positives = 32/59 (54%) Frame = +2 Query: 353 VQGSQEAKEDDHDVFASQFFHTYSLPVNSSAADVTAELTSDGYLVVTAPISENVDKTKK 529 V +E K+DD+D F S FH ++ + ++ + + L G+L + + E + K++K Sbjct: 69 VDYKEEEKKDDNDDFGS-LFHRFAFLMPNA---INSALLMVGFLALFFGLQETLQKSEK 123 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,510,475 Number of Sequences: 59808 Number of extensions: 290678 Number of successful extensions: 904 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 842 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 904 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1584657875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -