BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11c05 (593 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L13200-4|AAA28191.2| 645|Caenorhabditis elegans Hypothetical pr... 31 0.47 AC006607-6|AAF60370.2| 496|Caenorhabditis elegans Hypothetical ... 28 4.4 Z69360-6|CAA93282.1| 599|Caenorhabditis elegans Hypothetical pr... 27 7.6 >L13200-4|AAA28191.2| 645|Caenorhabditis elegans Hypothetical protein ZK1236.1 protein. Length = 645 Score = 31.5 bits (68), Expect = 0.47 Identities = 13/44 (29%), Positives = 28/44 (63%) Frame = +3 Query: 36 RSILLCFAVLLVERADAMIPAYSVSALRLAFDEIATVLPVANQL 167 RS+ +C +LL+ A+ + A +++ LAF++ ++PV N++ Sbjct: 121 RSLAVCDGILLLVAANQGVQAQTIANFWLAFEKNIQIIPVINKI 164 >AC006607-6|AAF60370.2| 496|Caenorhabditis elegans Hypothetical protein C09E7.5 protein. Length = 496 Score = 28.3 bits (60), Expect = 4.4 Identities = 9/37 (24%), Positives = 22/37 (59%) Frame = -1 Query: 350 QRNQHTDVQEEDARQIRQRCVKQRQSATKIRQYCRRQ 240 + N H +Q E+ + + Q + Q+Q++T ++C ++ Sbjct: 284 EANAHLSIQNEEQKNLIQNLLDQQQTSTSNAKWCSKK 320 >Z69360-6|CAA93282.1| 599|Caenorhabditis elegans Hypothetical protein F25H8.6 protein. Length = 599 Score = 27.5 bits (58), Expect = 7.6 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 347 RNQHTDVQEEDARQIRQRCVKQRQS 273 +N+ TDV+EED Q R R + R S Sbjct: 294 KNEPTDVEEEDLEQKRSRDILHRPS 318 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,978,684 Number of Sequences: 27780 Number of extensions: 152072 Number of successful extensions: 556 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 545 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 556 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1258229602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -