BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11c03 (525 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g58300.1 68418.m07298 leucine-rich repeat transmembrane prote... 29 1.4 At1g04140.2 68414.m00404 transducin family protein / WD-40 repea... 28 4.4 At1g04140.1 68414.m00403 transducin family protein / WD-40 repea... 28 4.4 At3g11310.1 68416.m01375 hypothetical protein 27 5.8 >At5g58300.1 68418.m07298 leucine-rich repeat transmembrane protein kinase, putative Length = 654 Score = 29.5 bits (63), Expect = 1.4 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Frame = -1 Query: 237 KVGISFHKGANRLN---GERFSHGNVNWSSVMETGCAITSLSRAGKAVTVAKPAKAMKTA 67 K+ +S KG L+ G +FSHGN+ S+V+ + +S G +A P M+ A Sbjct: 461 KITLSAAKGIAHLHAAGGPKFSHGNIKSSNVIMKQESDACISDFGLTPLMAVPIAPMRGA 520 Query: 66 KRRGENI 46 R + Sbjct: 521 GYRAPEV 527 >At1g04140.2 68414.m00404 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to neural cell adhesion molecule 2, large isoform precursor gb|M76710 from Xenopus laevis, and beta transducin from S. cerevisiae gb|Q05946. ESTs gb|N65081 gb|Z30910, gb|Z34190, gb|Z34611, gb|R30101, gb|H36304, and gb|N65606 come from Length = 793 Score = 27.9 bits (59), Expect = 4.4 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -1 Query: 492 VTTRYPSEVSSAVTSAALEFTGRL*VWKN 406 V R PSE++S++ +A L T +L VW + Sbjct: 536 VVNRIPSELASSIAAAELPCTVKLRVWSH 564 >At1g04140.1 68414.m00403 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to neural cell adhesion molecule 2, large isoform precursor gb|M76710 from Xenopus laevis, and beta transducin from S. cerevisiae gb|Q05946. ESTs gb|N65081 gb|Z30910, gb|Z34190, gb|Z34611, gb|R30101, gb|H36304, and gb|N65606 come from Length = 790 Score = 27.9 bits (59), Expect = 4.4 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -1 Query: 492 VTTRYPSEVSSAVTSAALEFTGRL*VWKN 406 V R PSE++S++ +A L T +L VW + Sbjct: 536 VVNRIPSELASSIAAAELPCTVKLRVWSH 564 >At3g11310.1 68416.m01375 hypothetical protein Length = 539 Score = 27.5 bits (58), Expect = 5.8 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 353 VQGSQEAKEDDHDVFASQFFHTYSLPVNSSAADVTAELT-SDG 478 V GS+ +DDH + F + P +SS D+ +T S+G Sbjct: 339 VPGSEGGADDDHHIVMDHHFESPHDPASSSEIDLNEPVTGSEG 381 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,325,456 Number of Sequences: 28952 Number of extensions: 155545 Number of successful extensions: 490 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 488 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 490 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 967280384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -