BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11b24 (603 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 27 0.47 AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 26 0.82 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 26 0.82 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 26 0.82 EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. 26 1.1 EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. 26 1.1 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 25 1.9 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 25 1.9 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 25 1.9 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 24 3.3 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 24 4.4 AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 pr... 24 4.4 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 5.8 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 23 5.8 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 23 5.8 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 23 5.8 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 23 5.8 EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. 23 5.8 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 23 5.8 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 23 5.8 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 23 5.8 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 23 5.8 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 23 5.8 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 23 5.8 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 23 5.8 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 23 5.8 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 23 5.8 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 23 5.8 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 23 5.8 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 23 5.8 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 23 5.8 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 23 5.8 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 23 5.8 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 23 5.8 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 23 5.8 EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. 23 7.6 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 7.6 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 7.6 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 23 7.6 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 27.1 bits (57), Expect = 0.47 Identities = 16/64 (25%), Positives = 30/64 (46%) Frame = +1 Query: 400 RSTTTEDIDDHLMSEEDMKQSLKMAKEAIANLERDLQKMDTKSSPKSAQMDEINLEAGAE 579 RS ++ I +H D + LK + I ++ ++QK +TK ++I +A Sbjct: 683 RSEYSQLIQEHEKELADFRAELKQTEANINSIVSEMQKTETKQGKSKDAFEKI--QADIR 740 Query: 580 VRKD 591 + KD Sbjct: 741 LMKD 744 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 26.2 bits (55), Expect = 0.82 Identities = 10/31 (32%), Positives = 22/31 (70%) Frame = +1 Query: 451 MKQSLKMAKEAIANLERDLQKMDTKSSPKSA 543 ++ + + AK+ +AN+E+ L ++ KSS K++ Sbjct: 753 LEDAYQSAKKTLANVEKKLAEVKAKSSDKNS 783 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 26.2 bits (55), Expect = 0.82 Identities = 20/72 (27%), Positives = 37/72 (51%) Frame = +1 Query: 352 VKLCDEEAALTSTGMGRSTTTEDIDDHLMSEEDMKQSLKMAKEAIANLERDLQKMDTKSS 531 VKL ++ AAL + S TT+++ + + +KQ +K KE + + ++L+ + Sbjct: 839 VKLEEQIAALQQRLVEVSGTTDEMTAAVTA---LKQQIKQHKEKMNSQSKELKAKYHQRD 895 Query: 532 PKSAQMDEINLE 567 Q DE+ LE Sbjct: 896 KLLKQNDELKLE 907 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 26.2 bits (55), Expect = 0.82 Identities = 14/59 (23%), Positives = 28/59 (47%) Frame = +1 Query: 424 DDHLMSEEDMKQSLKMAKEAIANLERDLQKMDTKSSPKSAQMDEINLEAGAEVRKDIDV 600 D + + +++K A N RDL + + + A+ D E A++RKD+++ Sbjct: 1445 DKYAEEASKLAENIKKRANATKNTARDLHHEADQLNGRLAKTDNRLEEREAQIRKDLNL 1503 >EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 25.8 bits (54), Expect = 1.1 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +K+ +G +++ EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLKQAVGQIELQNATEEQ 428 >EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.8 bits (54), Expect = 1.1 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +K+ +G +++ EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLKQAVGQIELQNATEEQ 428 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.0 bits (52), Expect = 1.9 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +K+ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLKQAVGLIELQHATEEQ 428 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.0 bits (52), Expect = 1.9 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +K+ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLKQAVGLIELQHATEEQ 428 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 25.0 bits (52), Expect = 1.9 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +K+ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLKQAVGLIELQHATEEQ 428 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 24.2 bits (50), Expect = 3.3 Identities = 19/89 (21%), Positives = 39/89 (43%), Gaps = 4/89 (4%) Frame = +1 Query: 280 HLYRDSDEEKRLTSSRENCNEKVKVKLCDEEAALTSTGMGRSTTTEDIDDHLMSEEDMKQ 459 HL RD++ R+ + + ++ DE AAL + G E++ D ++++ Sbjct: 985 HLLRDAESWSRICEAAKRITASLQQAWDDERAALAA--HGNEQHFEEVADLEARRAEIRR 1042 Query: 460 S----LKMAKEAIANLERDLQKMDTKSSP 534 + ++ A +R+LQ+ SP Sbjct: 1043 ARNDRRNASRRAARARQRELQRAGRPPSP 1071 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.8 bits (49), Expect = 4.4 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIG 276 +D+ +SNGR HA+ +K+ +G Sbjct: 394 LDEQVSNGRRAHAELDGTLKQAVG 417 >AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 23.8 bits (49), Expect = 4.4 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +3 Query: 63 IYYHSSPSPVRGTFRHI*NTKW 128 +YY+ P+ G +I TKW Sbjct: 103 VYYNEKDDPISGHLFNIEGTKW 124 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.4 bits (48), Expect = 5.8 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 444 RRYETKFENGKRSNSESRKRST 509 RR++ + EN + NS+ KR T Sbjct: 1579 RRFKKRKENDSKLNSDQNKRRT 1600 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +++ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQ 428 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +++ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQ 428 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +++ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQ 428 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +++ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQ 428 >EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +++ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQ 428 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +++ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQ 428 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +++ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQ 428 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +++ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQ 428 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +++ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQ 428 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +++ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQ 428 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +++ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQ 428 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +++ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQ 428 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +++ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQ 428 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +++ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQ 428 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +++ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQ 428 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +++ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQ 428 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +++ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQ 428 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +++ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLQQAVGLIELQHATEEQ 428 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +++ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQ 428 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +++ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLQQAVGLIELQHATEEQ 428 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +++ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLQQAVGLIELQHATEEQ 428 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIGYHLYRDSDEEK 309 +D+ +SNGR HA+ +++ +G + + EE+ Sbjct: 394 LDEQVSNGRRAHAELDGTLQQAVGQIELQHATEEQ 428 >EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.0 bits (47), Expect = 7.6 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 205 VDDGISNGRSLHAKKPIIVKKKIG 276 +D+ +SNGR HA+ +K +G Sbjct: 394 LDEQVSNGRRAHAELDGTLKXAVG 417 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.0 bits (47), Expect = 7.6 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 160 KSTAQAELDHHLNQNVDDGISNGRSL 237 +ST A + +LN N+D + GRSL Sbjct: 868 RSTMSAGMPLNLNLNLDRSEAGGRSL 893 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 7.6 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -1 Query: 120 CFKCV*MFP*LGWGCYDSIYHSKQHY 43 C KC+ LGW D+ KQHY Sbjct: 8 CEKCL---AHLGWSDLDTFVQIKQHY 30 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 23.0 bits (47), Expect = 7.6 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -1 Query: 120 CFKCV*MFP*LGWGCYDSIYHSKQHY 43 C KC+ LGW D+ KQHY Sbjct: 8 CEKCL---AHLGWSDLDTFVQIKQHY 30 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.315 0.129 0.353 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 528,760 Number of Sequences: 2352 Number of extensions: 8996 Number of successful extensions: 61 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58450473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -