BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11b18 (591 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. 24 4.2 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 7.4 DQ013849-1|AAY40258.1| 264|Anopheles gambiae CYP325C2 protein. 23 9.8 >AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. Length = 194 Score = 23.8 bits (49), Expect = 4.2 Identities = 8/24 (33%), Positives = 17/24 (70%) Frame = +3 Query: 39 LLCLTLVQSISCSIFMTKQHSQDD 110 +LC L+ +++ ++ +T QH+Q D Sbjct: 59 VLCCVLLLTLTLTVAVTAQHNQAD 82 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 7.4 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 Query: 62 EHLLQHLHDETTQSG*HHSTPS 127 +H LQH H HHS+ S Sbjct: 1327 QHQLQHHHQPQLSQSSHHSSSS 1348 >DQ013849-1|AAY40258.1| 264|Anopheles gambiae CYP325C2 protein. Length = 264 Score = 22.6 bits (46), Expect = 9.8 Identities = 11/30 (36%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +3 Query: 387 INHGDSVVWKNIEMA-SGPNSPVQTEQDIE 473 + + + V+ +++ +A SGPN QT +DIE Sbjct: 120 LTYMERVIKESLRLAPSGPNIARQTMKDIE 149 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 496,590 Number of Sequences: 2352 Number of extensions: 8512 Number of successful extensions: 23 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56768445 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -