BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11b16 (621 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 23 2.7 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 6.3 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 21 6.3 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 6.3 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 22.6 bits (46), Expect = 2.7 Identities = 17/56 (30%), Positives = 21/56 (37%) Frame = -1 Query: 282 SPSTLHLQRTHYNYTHSIHP*TFQFCRRTLGHLAQTHPRMS*DFCERDYSCISLSK 115 +P TL QR + + CR+ G A S D C D SC S K Sbjct: 72 TPETLRCQREGFFHEREPCIAGSAPCRKNTGRCAFDGICCSQDSCHADKSCASDDK 127 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.4 bits (43), Expect = 6.3 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 454 AKYSLLCLATRLKFCRHLI 398 AK+ + L L++C HLI Sbjct: 41 AKFEITDLEPALQYCTHLI 59 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 21.4 bits (43), Expect = 6.3 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = +3 Query: 426 VARHNREYLAGIQSYSLHLNHFGDMHVTEYFGKVLKLIKA 545 +AR+N E L + N F + YF K+ L+ + Sbjct: 240 IARYNFERLCNKLKRATRFNDFNEAIKEAYFPKLDSLVSS 279 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.4 bits (43), Expect = 6.3 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -1 Query: 288 HASPSTLHLQRTHYNYTHSIHP 223 H +P + HL++ +T S HP Sbjct: 348 HHNPMSHHLKQEPSGFTSSNHP 369 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,909 Number of Sequences: 336 Number of extensions: 3375 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15875032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -