Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmov11b15
         (617 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ314781-1|ABC54566.1|  407|Anopheles gambiae OSKAR protein.           24   3.4  
AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr...    24   3.4  

>DQ314781-1|ABC54566.1|  407|Anopheles gambiae OSKAR protein.
          Length = 407

 Score = 24.2 bits (50), Expect = 3.4
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = -1

Query: 596 KDKGQTQPHVVGHED*HQHVRGGRLNEVEARL 501
           K  G   PHV+ ++   QH+ G   NE+ A+L
Sbjct: 367 KVSGSIMPHVLWNKLGRQHMLGVLGNEIAAQL 398


>AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine
            protease protein.
          Length = 1322

 Score = 24.2 bits (50), Expect = 3.4
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = -3

Query: 228  HDCGHVQRMGRRC 190
            H+CGH + +G RC
Sbjct: 1013 HNCGHTEDVGVRC 1025


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 636,582
Number of Sequences: 2352
Number of extensions: 13680
Number of successful extensions: 29
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 28
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 60553008
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)