BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11b14 (644 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g41780.1 68415.m05164 expressed protein 28 6.1 At4g17700.1 68417.m02644 hypothetical protein contains Pfam prof... 27 8.1 >At2g41780.1 68415.m05164 expressed protein Length = 127 Score = 27.9 bits (59), Expect = 6.1 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +2 Query: 140 DHLTRQAVKNVSRQPLHNIENMGKVVSAGPTKPNEPTKKGETKKSFLSN 286 DH R AVK SR + ++E MG S + +PT E K + N Sbjct: 65 DH--RLAVKKASRSEMVDLEGMGSEASVIMSNVPQPTSFSEDHKLAIKN 111 >At4g17700.1 68417.m02644 hypothetical protein contains Pfam profile PF04776: Protein of unknown function (DUF626) Length = 254 Score = 27.5 bits (58), Expect = 8.1 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +3 Query: 318 VKCSPLVL*MWVLSYILMRMVIKDVHLKKLSSPNLSTMIII 440 VK S L+ W+ Y M + HL+ +PNLS ++I+ Sbjct: 143 VKKSELLTHDWIRLY--MELAFLKAHLRSPKNPNLSKLVIV 181 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,501,390 Number of Sequences: 28952 Number of extensions: 244066 Number of successful extensions: 595 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 586 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 595 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1334473344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -