BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11b12 (593 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 28 0.068 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 22 4.5 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 7.8 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 27.9 bits (59), Expect = 0.068 Identities = 15/33 (45%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Frame = +3 Query: 411 NLNPKTYCNIL-LCRILVYLYSSKMNKVEYSMM 506 +L + Y NIL CRI+VYL +S +N + Y++M Sbjct: 323 HLEIEKYYNILYFCRIMVYL-NSAINPILYNLM 354 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 21.8 bits (44), Expect = 4.5 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -2 Query: 259 GFIAESGPDERVHLCHVSTQPKQPTCRCC 173 G I E +RVH V++ +P R C Sbjct: 223 GRIVERFTSDRVHAALVTSPRARPLARTC 251 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.0 bits (42), Expect = 7.8 Identities = 6/10 (60%), Positives = 6/10 (60%) Frame = -2 Query: 154 NNPSVWSFRC 125 NNP W F C Sbjct: 662 NNPGFWLFHC 671 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,731 Number of Sequences: 336 Number of extensions: 3405 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14935063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -