BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11b12 (593 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3903| Best HMM Match : RVT_1 (HMM E-Value=4.5e-17) 29 2.8 SB_46909| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.00039) 29 2.8 >SB_3903| Best HMM Match : RVT_1 (HMM E-Value=4.5e-17) Length = 609 Score = 29.1 bits (62), Expect = 2.8 Identities = 18/73 (24%), Positives = 35/73 (47%), Gaps = 4/73 (5%) Frame = -2 Query: 256 FIAESG-PDERVHLCHVSTQPKQPTCRCC*Y*HHLNNPS---VWSFRCEDGANNTNHTPK 89 F+ ++G P + V + V + +QP+C+ C Y H +P+ + C+ + T H K Sbjct: 98 FVPQTGVPSKTVSVQPVQVKKEQPSCKFCGYRHSFAHPTRCPAFKRNCKI-CSKTGHFAK 156 Query: 88 DGENEDRDKGVAH 50 +N+ + H Sbjct: 157 MCKNKQKKDPEVH 169 >SB_46909| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.00039) Length = 685 Score = 29.1 bits (62), Expect = 2.8 Identities = 10/25 (40%), Positives = 19/25 (76%) Frame = -1 Query: 539 IKIGHKYRLTVHHRVFNFIHLRTIE 465 +++GH RLT+ HR +N +H R+++ Sbjct: 283 VRVGHVQRLTIFHRHYN-VHTRSLK 306 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,683,677 Number of Sequences: 59808 Number of extensions: 397740 Number of successful extensions: 775 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 775 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -