BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11b11 (593 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 5.2 EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. 21 9.1 DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 21 9.1 AF134818-1|AAD40234.1| 130|Apis mellifera lambda crystallin-lik... 21 9.1 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 21 9.1 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.8 bits (44), Expect = 5.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 143 SVNKTIKSSNQLPMSSSYD 199 S N+ IKS + P SSS D Sbjct: 93 SDNENIKSQKEFPNSSSSD 111 >EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. Length = 200 Score = 21.0 bits (42), Expect = 9.1 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 567 IVSLKVSCGRGMFLAPMN 514 IVS +V CGR + P N Sbjct: 103 IVSTRVRCGRSLEGYPFN 120 >DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large subunit protein. Length = 296 Score = 21.0 bits (42), Expect = 9.1 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = +2 Query: 476 KPVISEKKMGSTIFIGAKNIPRPQLTFKDTIDNSENLWV 592 KP+ + K++ S I G N+ R T D+ W+ Sbjct: 44 KPLWTGKQISSLIIPGNVNMIRTHSTXPXEEDDGPYKWI 82 >AF134818-1|AAD40234.1| 130|Apis mellifera lambda crystallin-like protein protein. Length = 130 Score = 21.0 bits (42), Expect = 9.1 Identities = 7/36 (19%), Positives = 20/36 (55%) Frame = +2 Query: 185 SSSYDLFKTYPEFNEISNQISQNVAQQSNELIGTEQ 292 +S YD+ T+ + ++++ ++ + NE+ E+ Sbjct: 72 NSIYDVSMTFGPVPKFEGEMAEKISNELNEMCPLEK 107 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 21.0 bits (42), Expect = 9.1 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 567 IVSLKVSCGRGMFLAPMN 514 IVS +V CGR + P N Sbjct: 119 IVSTRVRCGRSLEGYPFN 136 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,186 Number of Sequences: 438 Number of extensions: 2811 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17359926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -