BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11b09 (553 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein ... 25 1.7 U21917-1|AAA73920.1| 271|Anopheles gambiae serine protease prot... 25 2.2 >AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein protein. Length = 705 Score = 25.0 bits (52), Expect = 1.7 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -1 Query: 247 LSAYWRASSPRLIFNSILSNFINPVTVLRNLSILPSGP 134 +SAY++ L+ N +L+ F+ + L P GP Sbjct: 120 ISAYFKFLRRLLVLNLVLALFVGSFVIFPQLLAGPEGP 157 >U21917-1|AAA73920.1| 271|Anopheles gambiae serine protease protein. Length = 271 Score = 24.6 bits (51), Expect = 2.2 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -1 Query: 265 IASDISLSAYWRASSPRLIFNSILSNFINPVTVLRNLSILPS 140 +A +SLS R + R+I + NF N V +L+ LPS Sbjct: 107 VAGSVSLSNGVRRAVARVITHERYGNFKNDVALLQLQLSLPS 148 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 534,446 Number of Sequences: 2352 Number of extensions: 9690 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51301854 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -