BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11b09 (553 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 22 4.8 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 4.8 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 4.8 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 6.3 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 21 8.3 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 21 8.3 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 21.8 bits (44), Expect = 4.8 Identities = 12/39 (30%), Positives = 17/39 (43%) Frame = -1 Query: 181 NPVTVLRNLSILPSGPLRFFNRRCSGLIFIRSFETSLET 65 NP + I PS F +C+ +F SF T+ T Sbjct: 95 NPFIGMGEFLIDPSLEDEFMGPKCAAFLFQLSFATTSTT 133 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 163 RNLSILPSGPLRFFN 119 RN+ ILPSG L N Sbjct: 1359 RNIQILPSGELMLSN 1373 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 4.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 163 RNLSILPSGPLRFFN 119 RN+ ILPSG L N Sbjct: 1355 RNIQILPSGELMLSN 1369 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 6.3 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +3 Query: 450 ELRGNPYPDLI 482 + RGNP PD+I Sbjct: 26 QARGNPQPDII 36 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.0 bits (42), Expect = 8.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 341 FMNKLFFKKPKIGHVHS 291 +M LFF K GH H+ Sbjct: 116 WMPDLFFSNEKEGHFHN 132 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.0 bits (42), Expect = 8.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 341 FMNKLFFKKPKIGHVHS 291 +M LFF K GH H+ Sbjct: 116 WMPDLFFSNEKEGHFHN 132 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,241 Number of Sequences: 438 Number of extensions: 3163 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15827139 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -