BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11b04 (688 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 27 0.73 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 27 0.73 AF513634-1|AAM53606.1| 216|Anopheles gambiae glutathione S-tran... 25 2.2 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 25 3.0 DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 24 3.9 AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 23 9.0 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 9.0 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 26.6 bits (56), Expect = 0.73 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Frame = +3 Query: 357 NPDSSDFGYTKTVQIHSYLSTSNCF---RKDGAA---TSCGQA*CVTNN*YHWY 500 +PD +D + Q+H +S N F R+ G A SCG+ VTN +H++ Sbjct: 493 SPDGTDLPHHTHYQLHHQMSYHNMFTPSREPGTAWRCRSCGKE--VTNRWHHFH 544 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 26.6 bits (56), Expect = 0.73 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Frame = +3 Query: 357 NPDSSDFGYTKTVQIHSYLSTSNCF---RKDGAA---TSCGQA*CVTNN*YHWY 500 +PD +D + Q+H +S N F R+ G A SCG+ VTN +H++ Sbjct: 469 SPDGTDLPHHTHYQLHHQMSYHNMFTPSREPGTAWRCRSCGKE--VTNRWHHFH 520 >AF513634-1|AAM53606.1| 216|Anopheles gambiae glutathione S-transferase D5 protein. Length = 216 Score = 25.0 bits (52), Expect = 2.2 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +1 Query: 175 NEVLSPATQNTLNAAKKIG 231 ++++SP+ QN L AKK+G Sbjct: 5 SDIVSPSCQNVLLVAKKLG 23 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 24.6 bits (51), Expect = 3.0 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = +1 Query: 475 SPITDIIGIKDANTFVRTIYAGNAILTLEAK--DPIKVI-TVRGTA 603 +PI D +G+K + IY +I+ AK DP+ ++ TV+ A Sbjct: 940 NPILDTLGVKISEPETCEIYTKRSIIRTIAKIYDPLGIVDTVKAKA 985 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 24.2 bits (50), Expect = 3.9 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +2 Query: 581 SSLFVAQHSLQSHWREGLQQLIKHL 655 ++ F+ + L W EGLQ +K+L Sbjct: 381 TATFLTRGGLWLSWEEGLQHFLKYL 405 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 23.0 bits (47), Expect = 9.0 Identities = 25/92 (27%), Positives = 41/92 (44%), Gaps = 2/92 (2%) Frame = +1 Query: 406 HILAPATAFGKTVLPRVAAKLDVSPITDIIG-IKDANTFVRTIYAGNAILTLEAKDPIKV 582 H PA F VL + A LD + I + I++ T ++TI +++L+ + Sbjct: 1145 HSFQPAPFF---VLDEIDAALDNTNIGKVASYIREKTTNLQTI-----VISLKEEFYCHA 1196 Query: 583 ITVRGTA-FPAEPLEGGSAAIDKAPEGDYKTD 675 + G +PAE L + D GDY+ D Sbjct: 1197 DVLIGICPYPAECLVSQTLIFDLEKYGDYRQD 1228 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.0 bits (47), Expect = 9.0 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -3 Query: 146 CKRRSCPDKNKCLLLGANILI 84 CKR CP+ C+ + + +I Sbjct: 773 CKRCPCPNNGACMQMAGDTVI 793 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 722,888 Number of Sequences: 2352 Number of extensions: 15431 Number of successful extensions: 27 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -