BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11a23 (271 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 21 2.4 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 3.1 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 20 4.1 AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory recept... 20 4.1 AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochr... 20 4.1 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 21.0 bits (42), Expect = 2.4 Identities = 11/25 (44%), Positives = 13/25 (52%), Gaps = 4/25 (16%) Frame = -2 Query: 204 LSDVTVLHHHC*KL----NDDFGTG 142 L + LHHH KL N+ FG G Sbjct: 219 LGKICTLHHHLSKLVTRFNEIFGLG 243 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 20.6 bits (41), Expect = 3.1 Identities = 11/25 (44%), Positives = 13/25 (52%), Gaps = 4/25 (16%) Frame = -2 Query: 204 LSDVTVLHHHC*KL----NDDFGTG 142 L + LHHH KL N+ FG G Sbjct: 851 LGKICTLHHHLSKLIRLFNEIFGHG 875 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 20.2 bits (40), Expect = 4.1 Identities = 10/23 (43%), Positives = 13/23 (56%), Gaps = 4/23 (17%) Frame = -2 Query: 204 LSDVTVLHHHC*KL----NDDFG 148 L+ + LHHH KL N+ FG Sbjct: 502 LNKICALHHHLSKLVKLFNETFG 524 >AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory receptor candidate 24 protein. Length = 384 Score = 20.2 bits (40), Expect = 4.1 Identities = 10/23 (43%), Positives = 13/23 (56%), Gaps = 4/23 (17%) Frame = -2 Query: 204 LSDVTVLHHHC*KL----NDDFG 148 L+ + LHHH KL N+ FG Sbjct: 227 LNKICALHHHLSKLVKLFNETFG 249 >AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q3 protein. Length = 143 Score = 20.2 bits (40), Expect = 4.1 Identities = 12/39 (30%), Positives = 16/39 (41%) Frame = -2 Query: 225 VIINDFKLSDVTVLHHHC*KLNDDFGTGPDEDLSFPSLF 109 V N KL T+ H H L+ + PD + P F Sbjct: 91 VTCNGLKLPKSTITHLHIYDLHHNPDIYPDPEKFDPERF 129 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 45,083 Number of Sequences: 336 Number of extensions: 719 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 47 effective length of database: 106,793 effective search space used: 4485306 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 37 (19.9 bits)
- SilkBase 1999-2023 -