BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11a21 (646 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC16E8.10c |||mitochondrial ribosomal protein subunit S7|Schiz... 41 1e-04 SPBC11C11.03 |ndc80|ndc10, tid3|spindle pole body protein Ndc80|... 29 0.57 SPBC13E7.05 |gpi14||pig-M|Schizosaccharomyces pombe|chr 2|||Manual 28 1.0 SPAC144.05 |||ATP-dependent DNA helicase|Schizosaccharomyces pom... 28 1.3 SPAC4A8.11c |fas2|lsd1|fatty acid synthase alpha subunit Lsd1 |S... 27 1.8 SPBP8B7.09c |||karyopherin|Schizosaccharomyces pombe|chr 2|||Manual 27 1.8 SPBC1709.01 |chs2|SPBC1734.17|chitin synthase homolog Chs2|Schiz... 27 1.8 SPAC32A11.04c |tif212|tif22, SPAC6B12.17c|translation initiation... 27 2.3 SPBC26H8.08c |grn1||GTPase Grn1 |Schizosaccharomyces pombe|chr 2... 27 2.3 SPAC1006.04c |mcp3|mug7|sequence orphan|Schizosaccharomyces pomb... 26 4.0 SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|S... 26 5.3 SPAC4G8.03c |||RNA-binding protein|Schizosaccharomyces pombe|chr... 26 5.3 SPAC22G7.06c |ura1||carbamoyl-phosphate synthase |Schizosaccharo... 25 7.1 SPAC631.02 |||bromodomain protein|Schizosaccharomyces pombe|chr ... 25 7.1 SPAC4F10.08 |mug126||sequence orphan|Schizosaccharomyces pombe|c... 25 9.3 SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual 25 9.3 >SPAC16E8.10c |||mitochondrial ribosomal protein subunit S7|Schizosaccharomyces pombe|chr 1|||Manual Length = 259 Score = 41.1 bits (92), Expect = 1e-04 Identities = 27/102 (26%), Positives = 49/102 (48%) Frame = +2 Query: 275 DPLVNKVINHVMEKGNKRLARQLVEKAFENIKRKQIERYHLASTPEEKAKIELNPKDILY 454 D V ++N +M G K A ++V A I+++ E NP D+L Sbjct: 123 DSTVQHLVNLIMRDGKKAKAEKIVATALSIIQKETGE----------------NPIDVLK 166 Query: 455 KAVENCKPLLQLQPIKRGGITYQVPGPITEKRSLFLAIKWLL 580 +A+ PL++L KR + + P P+ E++ +A++W+L Sbjct: 167 QAIAEISPLMKLVSAKRFNKSVEFPMPLKERQRRRIALQWIL 208 >SPBC11C11.03 |ndc80|ndc10, tid3|spindle pole body protein Ndc80|Schizosaccharomyces pombe|chr 2|||Manual Length = 624 Score = 29.1 bits (62), Expect = 0.57 Identities = 19/79 (24%), Positives = 36/79 (45%) Frame = +2 Query: 290 KVINHVMEKGNKRLARQLVEKAFENIKRKQIERYHLASTPEEKAKIELNPKDILYKAVEN 469 ++IN + A Q++E+ + ++R +++ S + K + N L +E Sbjct: 283 ELINQIKSAEELDSAIQVLEERYRTMQRDEVKFQSAMSGMKSKMESRTNLMKQLQVNIEE 342 Query: 470 CKPLLQLQPIKRGGITYQV 526 + LQL KR + YQV Sbjct: 343 KESQLQLLKEKRDSLKYQV 361 >SPBC13E7.05 |gpi14||pig-M|Schizosaccharomyces pombe|chr 2|||Manual Length = 815 Score = 28.3 bits (60), Expect = 1.0 Identities = 23/66 (34%), Positives = 34/66 (51%), Gaps = 4/66 (6%) Frame = -1 Query: 430 LYFGF--FFWCRSQMVSFN--LFPFDIFECFLNELTSQSFVTFFHHMVDDFINERIKVNG 263 LY+ F F +S ++S++ LF F + F+ L SQSF+ V DFIN + Sbjct: 171 LYYCFVQFMEVKSALISYDRSLFKFYPIDLFVL-LLSQSFICIIAFGVSDFIN--FQKEE 227 Query: 262 RRFRNR 245 R FR + Sbjct: 228 RNFRGK 233 >SPAC144.05 |||ATP-dependent DNA helicase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1375 Score = 27.9 bits (59), Expect = 1.3 Identities = 28/114 (24%), Positives = 52/114 (45%) Frame = +2 Query: 35 NVLIFFYRRLKNSSFNSSTRTLSKLQIRNYAKATSFPDYYQNPIFRKEDQVKLIADSDLK 214 N I +Y++L+ S + +S + + NY K + N + K +I + ++ Sbjct: 963 NSRIEYYKQLQEISDSLMPPPVSNISLNNYVKDDEKKQKFLNSVIIK---ASVILEKEIS 1019 Query: 215 NRATVPVKPPTVSETSSVYFDPLVNKVINHVMEKGNKRLARQLVEKAFENIKRK 376 K S+T++V LVN+ I+ + G+ L R+L E+ N +RK Sbjct: 1020 E------KQDEASQTTNV--AELVNQKISEMNIPGHIHLLRELEEEK-SNTQRK 1064 >SPAC4A8.11c |fas2|lsd1|fatty acid synthase alpha subunit Lsd1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1842 Score = 27.5 bits (58), Expect = 1.8 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = +2 Query: 386 RYHLASTPEEKAKIELNPKDILYKAVENCKPLLQLQPI 499 +YH+ P EK + K + + ++NCK ++ P+ Sbjct: 448 QYHIDHCPAEKGETYQLAKTLGQQLIDNCKSVIDAPPV 485 >SPBP8B7.09c |||karyopherin|Schizosaccharomyces pombe|chr 2|||Manual Length = 978 Score = 27.5 bits (58), Expect = 1.8 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Frame = +2 Query: 251 SETSSVYFDPLVNKVI---NHVMEKGNKRLARQLVEK 352 +E + VYFDPL+N ++ N V E ++ + LV K Sbjct: 829 TEENQVYFDPLINSILHFANLVGEPATQKSSIALVSK 865 >SPBC1709.01 |chs2|SPBC1734.17|chitin synthase homolog Chs2|Schizosaccharomyces pombe|chr 2|||Manual Length = 926 Score = 27.5 bits (58), Expect = 1.8 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 32 SNVLIFFYRR-LKNSSFNSSTRTLSKLQIRNYAKATSFPDYYQN 160 +NVL Y LKN S ++ T +Q Y K S+ D+YQ+ Sbjct: 804 ANVLNSVYNSSLKNFSSSNDTSVYHDVQDHCYRKPQSYEDHYQD 847 >SPAC32A11.04c |tif212|tif22, SPAC6B12.17c|translation initiation factor eIF2 beta subunit|Schizosaccharomyces pombe|chr 1|||Manual Length = 321 Score = 27.1 bits (57), Expect = 2.3 Identities = 15/54 (27%), Positives = 22/54 (40%) Frame = +2 Query: 347 EKAFENIKRKQIERYHLASTPEEKAKIELNPKDILYKAVENCKPLLQLQPIKRG 508 +K EN+ R+ I Y T + I I + E C + +Q IK G Sbjct: 256 QKQIENVLRRYIVEYVTCKTCKSPDTILTKENRIFFMTCEACGSVRSVQAIKTG 309 >SPBC26H8.08c |grn1||GTPase Grn1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 470 Score = 27.1 bits (57), Expect = 2.3 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 6/54 (11%) Frame = +2 Query: 359 ENIKRKQIERYHLASTPEEKA------KIELNPKDILYKAVENCKPLLQLQPIK 502 E + K +ER LAS+ EEK KI+L P ++L K V + P++ Sbjct: 176 EGTRSKDVERQVLASSAEEKRLIFVINKIDLVPSEVLNKWVTYLRNFFPTIPMR 229 >SPAC1006.04c |mcp3|mug7|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 952 Score = 26.2 bits (55), Expect = 4.0 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +2 Query: 281 LVNKVINHVMEKGNKRLARQLVEKAFENIKRKQIERYHLASTPEEKAKIELN 436 LV+K N + +K N ARQL++K+ + + + + EEK I N Sbjct: 264 LVSKHNNALEDKFNSEAARQLLQKSLSIVASNLKQAENKTISYEEKLSIAQN 315 >SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|Schizosaccharomyces pombe|chr 3|||Manual Length = 551 Score = 25.8 bits (54), Expect = 5.3 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 5/56 (8%) Frame = +2 Query: 152 YQNPIFRKEDQV-----KLIADSDLKNRATVPVKPPTVSETSSVYFDPLVNKVINH 304 ++NP RK K+ + + K T PVKPP + ++ +F + N+V NH Sbjct: 361 HKNPNLRKTGPTPGPKPKIKSSAPSKPAETAPVKPPRIELENTKWF--VENQVDNH 414 >SPAC4G8.03c |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 780 Score = 25.8 bits (54), Expect = 5.3 Identities = 9/35 (25%), Positives = 21/35 (60%) Frame = +2 Query: 287 NKVINHVMEKGNKRLARQLVEKAFENIKRKQIERY 391 N ++ HV+E + +++EK F NI + ++++ Sbjct: 658 NYLVQHVLELNIQPYTERIIEKFFGNICKLSLQKF 692 >SPAC22G7.06c |ura1||carbamoyl-phosphate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 2244 Score = 25.4 bits (53), Expect = 7.1 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 388 SFNLFPFDIFECFLNELTSQSFVTFFHHMVDD 293 +F++ E ++ELTS+S FFH DD Sbjct: 1605 NFSVIASSTNEVTISELTSESGCLFFHFEKDD 1636 >SPAC631.02 |||bromodomain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 727 Score = 25.4 bits (53), Expect = 7.1 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 2/85 (2%) Frame = +2 Query: 209 LKNRA-TVPVKPPTVSETSSV-YFDPLVNKVINHVMEKGNKRLARQLVEKAFENIKRKQI 382 +K+RA + V + S + SV + P+ ++ N + E+ N A QL A I R + Sbjct: 554 MKSRARSSSVSRRSRSRSLSVDIYPPITYEMQNELAEQCNYLSADQLSHVA--EILRAAL 611 Query: 383 ERYHLASTPEEKAKIELNPKDILYK 457 HL +T E + + P D+ YK Sbjct: 612 P--HLRNTDEIEIDVSAMPPDVFYK 634 >SPAC4F10.08 |mug126||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 436 Score = 25.0 bits (52), Expect = 9.3 Identities = 24/101 (23%), Positives = 43/101 (42%), Gaps = 2/101 (1%) Frame = -1 Query: 478 WFAIFNGFI*NVLRI*LYFGFFFWCRSQMVSFNLFPFDIFECFLNELTSQSF--VTFFHH 305 + A+F F+ + R+ +Y G FW + + F +F CFL + F + + Sbjct: 322 YLALFRNFLNILKRMAIYCGACFW----VYACIFFLTRVF-CFLIDTPYPQFEKIPLEIY 376 Query: 304 MVDDFINERIKVNGRRFRNRRWLHRYSCSVLQIRICNEFHL 182 + IN I G +F NR + ++L R + + L Sbjct: 377 SIFAAINVYIIELGGKFSNRAKFNNLCSNILHFRALSAYSL 417 >SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual Length = 1828 Score = 25.0 bits (52), Expect = 9.3 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = +3 Query: 459 PLKIANHCYNYSPSRGVVSHTR-CLDQSLK 545 P K++NH YN V++ R C+ S+K Sbjct: 538 PQKLSNHLYNLCVKSSNVNYARECISLSIK 567 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,805,780 Number of Sequences: 5004 Number of extensions: 59702 Number of successful extensions: 218 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 213 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 218 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 289756512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -