BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11a19 (746 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578802-1|AAT07307.1| 108|Anopheles gambiae FK506-binding prot... 105 1e-24 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 24 5.7 >AY578802-1|AAT07307.1| 108|Anopheles gambiae FK506-binding protein protein. Length = 108 Score = 105 bits (252), Expect = 1e-24 Identities = 48/89 (53%), Positives = 61/89 (68%) Frame = +1 Query: 409 RKGDLLHMHYTGTLDDGTEFDSSIPRGNPLTFKLGSGQVIKGWDQGLLGMCEGEQRKLVI 588 + G +HYTGTLDDGT FDSS RG P F +G G+VI+GWD+G+ M G++ KLV Sbjct: 18 KPGQTAVVHYTGTLDDGTVFDSSRTRGKPFKFSVGKGEVIRGWDEGVAQMSVGQRAKLVC 77 Query: 589 PPELAYGSAGAPPKIPKSATLTFHVELVK 675 P+ AYGS G P IP +A LTF VEL++ Sbjct: 78 SPDYAYGSRGHPGVIPPNARLTFDVELLR 106 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 23.8 bits (49), Expect = 5.7 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 663 YVKSKSSRLWYLWWCSS*TISQFRWNDK 580 YV ++ S LW LW S I++ W K Sbjct: 112 YVVNEFSWLWLLWLLSQTWITRHLWMAK 139 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 649,409 Number of Sequences: 2352 Number of extensions: 11733 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -