BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11a19 (746 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g48580.1 68418.m06009 FK506-binding protein 2-2 (FKBP15-2) / ... 145 2e-35 At3g25220.1 68416.m03150 FK506-binding protein 2-1 (FKBP15-1) / ... 143 1e-34 At3g25230.1 68416.m03152 peptidyl-prolyl cis-trans isomerase / F... 114 5e-26 At5g48570.1 68418.m06007 peptidyl-prolyl cis-trans isomerase, pu... 114 7e-26 At5g45680.1 68418.m05616 FK506-binding protein 1 (FKBP13) identi... 95 4e-20 At4g25340.1 68417.m03647 immunophilin-related / FKBP-type peptid... 83 3e-16 At4g39710.1 68417.m05620 immunophilin, putative / FKBP-type pept... 79 4e-15 At3g12340.1 68416.m01538 immunophilin, putative / FKBP-type pept... 77 2e-14 At5g05420.1 68418.m00584 immunophilin, putative / FKBP-type pept... 76 3e-14 At3g55520.1 68416.m06165 immunophilin, putative / FKBP-type pept... 76 3e-14 At2g43560.1 68415.m05412 immunophilin / FKBP-type peptidyl-proly... 66 2e-11 At5g64350.1 68418.m08082 FK506-binding protein (FKBP12) / immuno... 60 2e-09 At3g10060.1 68416.m01206 immunophilin, putative / FKBP-type pept... 56 2e-08 At3g60370.1 68416.m06752 immunophilin / FKBP-type peptidyl-proly... 52 5e-07 At3g54010.2 68416.m05972 peptidyl-prolyl cis-trans isomerase, pu... 49 3e-06 At3g54010.1 68416.m05971 peptidyl-prolyl cis-trans isomerase, pu... 49 3e-06 At4g19830.1 68417.m02907 immunophilin / FKBP-type peptidyl-proly... 45 5e-05 At5g13410.1 68418.m01544 immunophilin / FKBP-type peptidyl-proly... 39 0.004 At4g26555.1 68417.m03826 immunophilin / FKBP-type peptidyl-proly... 37 0.012 At1g20810.1 68414.m02606 immunophilin / FKBP-type peptidyl-proly... 36 0.029 At3g21640.1 68416.m02729 FKBP-type peptidyl-prolyl cis-trans iso... 35 0.050 At5g55370.1 68418.m06899 long-chain-alcohol O-fatty-acyltransfer... 29 2.5 At5g66310.1 68418.m08360 kinesin motor family protein contains P... 28 5.7 At4g24170.1 68417.m03468 kinesin motor family protein contains P... 28 7.6 At1g68910.1 68414.m07886 expressed protein similar to Myosin hea... 28 7.6 At4g39110.1 68417.m05538 protein kinase family protein contains ... 27 10.0 At3g51150.1 68416.m05601 kinesin motor family protein contains P... 27 10.0 At2g21480.1 68415.m02556 protein kinase family protein contains ... 27 10.0 >At5g48580.1 68418.m06009 FK506-binding protein 2-2 (FKBP15-2) / immunophilin / peptidyl-prolyl cis-trans isomerase / rotamase identical to SP|Q38936| FK506-binding protein 2-2 precursor (EC 5.2.1.8); Length = 163 Score = 145 bits (352), Expect = 2e-35 Identities = 64/105 (60%), Positives = 78/105 (74%) Frame = +1 Query: 358 KLQIGIKKRPEDCSIKSRKGDLLHMHYTGTLDDGTEFDSSIPRGNPLTFKLGSGQVIKGW 537 +LQIG+K +P+ C +++ KGD + +HY G L DGT FDSS RG+P FKLGSGQVIKGW Sbjct: 33 ELQIGVKFKPKTCEVQAHKGDTIKVHYRGKLTDGTVFDSSFERGDPFEFKLGSGQVIKGW 92 Query: 538 DQGLLGMCEGEQRKLVIPPELAYGSAGAPPKIPKSATLTFHVELV 672 DQGLLG C GE+RKL IP +L YG G+PP IP ATL F EL+ Sbjct: 93 DQGLLGACVGEKRKLKIPAKLGYGEQGSPPTIPGGATLIFDTELI 137 >At3g25220.1 68416.m03150 FK506-binding protein 2-1 (FKBP15-1) / immunophilin / peptidyl-prolyl cis-trans isomerase / rotamase identical to SP|Q38935 FK506-binding protein 2-1 precursor (EC 5.2.1.8) (Peptidyl-prolyl cis- trans isomerase) (PPiase) (Rotamase) (15 kDa FKBP) (FKBP-15-1) {Arabidopsis thaliana}, immunophilin (FKBP15-1) GB:U52046 [Arabidopsis thaliana] (Proc. Natl. Acad. Sci. U.S.A. 93 (14), 6964-6969 (1996)) Length = 153 Score = 143 bits (347), Expect = 1e-34 Identities = 63/105 (60%), Positives = 79/105 (75%) Frame = +1 Query: 358 KLQIGIKKRPEDCSIKSRKGDLLHMHYTGTLDDGTEFDSSIPRGNPLTFKLGSGQVIKGW 537 +LQIG+K +P+ C +++ KGD + +HY G L DGT FDSS RG+P+ F+LG+GQVI GW Sbjct: 33 ELQIGVKYKPQKCDLQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIEFELGTGQVIPGW 92 Query: 538 DQGLLGMCEGEQRKLVIPPELAYGSAGAPPKIPKSATLTFHVELV 672 DQGLLG C GE+RKL IP +L YG G+PPKIP ATL F ELV Sbjct: 93 DQGLLGACVGEKRKLKIPSKLGYGDNGSPPKIPGGATLIFDTELV 137 >At3g25230.1 68416.m03152 peptidyl-prolyl cis-trans isomerase / FK506-binding protein (ROF1) identical to rotamase FKBP (ROF1) GB:U49453 [Arabidopsis thaliana] (Mol. Gen. Genet. 252 (5), 510-517 (1996)) Length = 551 Score = 114 bits (275), Expect = 5e-26 Identities = 60/116 (51%), Positives = 75/116 (64%), Gaps = 3/116 (2%) Frame = +1 Query: 355 KKLQIGIKKR--PEDCSIKS-RKGDLLHMHYTGTLDDGTEFDSSIPRGNPLTFKLGSGQV 525 K++Q G+KK+ E ++ GD + +HYTGTL DGT+FDSS R P F LG GQV Sbjct: 34 KEIQQGLKKKLLKEGEGYETPENGDEVEVHYTGTLLDGTKFDSSRDRATPFKFTLGQGQV 93 Query: 526 IKGWDQGLLGMCEGEQRKLVIPPELAYGSAGAPPKIPKSATLTFHVELVKNXKEKD 693 IKGWD G+ M +GE IP ELAYG +G+PP IP +ATL F VEL+K KD Sbjct: 94 IKGWDIGIKTMKKGENAVFTIPAELAYGESGSPPTIPANATLQFDVELLKWDSVKD 149 Score = 51.2 bits (117), Expect = 7e-07 Identities = 31/102 (30%), Positives = 54/102 (52%), Gaps = 5/102 (4%) Frame = +1 Query: 403 KSRKGDLLHMHYTGTLDDGTEFDSSIPRGN--PLTFKLGSGQVIKGWDQGLLGMCEGEQR 576 + +G ++ + G L DGT F N P FK QV+ G D+ ++ M +GE Sbjct: 286 RPNEGAVVKVKLIGKLQDGTVFLKKGHGENEEPFEFKTDEEQVVDGLDRAVMKMKKGEVA 345 Query: 577 KLVIPPELAYGSAGAPPK---IPKSATLTFHVELVKNXKEKD 693 + I PE A+GS + + +P ++T+T+ V+L+ KE++ Sbjct: 346 LVTIDPEYAFGSNESQQELAVVPPNSTVTYEVDLLTFDKERE 387 Score = 32.7 bits (71), Expect = 0.27 Identities = 22/90 (24%), Positives = 42/90 (46%), Gaps = 5/90 (5%) Frame = +1 Query: 418 DLLHMHYTGTLDDGTEFDSSIPRGNPLTFKLGSGQVIKGWDQGLLGMCEGEQRKLVIPPE 597 D + + + L+DGT + + + + F + G + + M +GE+ L + P+ Sbjct: 174 DEVLVKFEAKLEDGTV----VGKSDGVEFTVKDGHFCPALTKAVKTMKKGEKVLLTVKPQ 229 Query: 598 LAYGSAGAPPK-----IPKSATLTFHVELV 672 +G G P +P +ATL ++ELV Sbjct: 230 YGFGEKGKPASAGEGAVPPNATLEINLELV 259 >At5g48570.1 68418.m06007 peptidyl-prolyl cis-trans isomerase, putative / FK506-binding protein, putative similar to rof1 [Arabidopsis thaliana] GI:1373396 Length = 578 Score = 114 bits (274), Expect = 7e-26 Identities = 58/111 (52%), Positives = 70/111 (63%), Gaps = 3/111 (2%) Frame = +1 Query: 370 GIKKR-PEDCSI--KSRKGDLLHMHYTGTLDDGTEFDSSIPRGNPLTFKLGSGQVIKGWD 540 G+KK+ ++C GD + +HYTGTL DGT+FDSS RG P F LG G VIKGWD Sbjct: 47 GLKKKLVKECEKWDTPENGDEVEVHYTGTLLDGTKFDSSRDRGTPFKFTLGQGHVIKGWD 106 Query: 541 QGLLGMCEGEQRKLVIPPELAYGSAGAPPKIPKSATLTFHVELVKNXKEKD 693 G+ M +GE IPPELAYG G+PP IP +ATL F VEL+ KD Sbjct: 107 LGIKTMKKGENAIFTIPPELAYGETGSPPTIPPNATLQFDVELIAWRSVKD 157 Score = 58.0 bits (134), Expect = 6e-09 Identities = 40/127 (31%), Positives = 68/127 (53%), Gaps = 8/127 (6%) Frame = +1 Query: 337 IESTASKKLQIGIKKRPEDCSIKSRKGDLLHMHYTGTLDDGTEFDSSIPRGN-----PLT 501 +E T +K+ I K E + +G ++ + G L DGT + +G+ P Sbjct: 274 VEVTDDRKVIKKILKEGEGYE-RPNEGAIVKLKLIGKLQDGTTV--FVKKGHEEDEEPFE 330 Query: 502 FKLGSGQVIKGWDQGLLGMCEGEQRKLVIPPELAYGSAGAPPK---IPKSATLTFHVELV 672 FK+ QVI+G ++ ++GM +GE + I PE A+GS+ + + IP ++T+ + VELV Sbjct: 331 FKIDEEQVIEGLEKAVMGMKKGEVALITISPEYAFGSSESKQELAVIPPNSTVYYEVELV 390 Query: 673 KNXKEKD 693 KEK+ Sbjct: 391 SFIKEKE 397 Score = 35.1 bits (77), Expect = 0.050 Identities = 25/96 (26%), Positives = 43/96 (44%), Gaps = 6/96 (6%) Frame = +1 Query: 403 KSRKGDLLHMHYTGTLDDGTEFDSSIPRGNPLTFKLGSGQVIKGWDQGLLGMCEGEQRKL 582 K + D +++ Y L+DGT + + + + F + G + + M GE+ L Sbjct: 177 KPKDLDEVYVKYEARLEDGT----IVGKSDGVEFTVKEGHFCPALSKAVKTMKRGEKVLL 232 Query: 583 VIPPELAYGSAGAPPK------IPKSATLTFHVELV 672 + P+ +G G P IP +ATL +ELV Sbjct: 233 TVKPQYGFGEFGRPASDGLQAAIPPNATLQIDLELV 268 >At5g45680.1 68418.m05616 FK506-binding protein 1 (FKBP13) identical to Probable FKBP-type peptidyl-prolyl cis-trans isomerase 3, chloroplast precursor (Ppiase) (Rotamase) (SP:Q9SCY2) / FK506 binding protein 1 (GI:21535744) [Arabidopsis thaliana]; contains Pfam PF00254: peptidyl-prolyl cis-trans isomerase, FKBP-type Length = 208 Score = 95.1 bits (226), Expect = 4e-20 Identities = 50/98 (51%), Positives = 62/98 (63%), Gaps = 11/98 (11%) Frame = +1 Query: 412 KGDLLHMHYTGTLDDGTEFDSSIPRGNPLTFKLGSGQVIKGWDQGLLG------MCEGEQ 573 KG L+ HY G L++G FDSS RG PLTF++G G+VIKGWDQG+LG M G + Sbjct: 108 KGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVGEVIKGWDQGILGSDGIPPMLTGGK 167 Query: 574 RKLVIPPELAYGSAGAPPK-----IPKSATLTFHVELV 672 R L IPPELAYG GA K IP ++ L F +E + Sbjct: 168 RTLRIPPELAYGDRGAGCKGGSCLIPPASVLLFDIEYI 205 >At4g25340.1 68417.m03647 immunophilin-related / FKBP-type peptidyl-prolyl cis-trans isomerase-related immunophilin FKBP46 - Spodoptera frugiperda (fall armyworm),PIR2:A55320 Length = 477 Score = 82.6 bits (195), Expect = 3e-16 Identities = 42/87 (48%), Positives = 57/87 (65%), Gaps = 1/87 (1%) Frame = +1 Query: 415 GDLLHMHYTGTLD-DGTEFDSSIPRGNPLTFKLGSGQVIKGWDQGLLGMCEGEQRKLVIP 591 G + + Y G L +G FDS+I + +P F+LG G VIKGWD G+ GM G++RKL IP Sbjct: 389 GKTVSVRYIGKLQKNGKIFDSNIGK-SPFKFRLGIGSVIKGWDVGVNGMRVGDKRKLTIP 447 Query: 592 PELAYGSAGAPPKIPKSATLTFHVELV 672 P + YG GA +IP ++ LTF VEL+ Sbjct: 448 PSMGYGVKGAGGQIPPNSWLTFDVELI 474 >At4g39710.1 68417.m05620 immunophilin, putative / FKBP-type peptidyl-prolyl cis-trans isomerase, putative similar to FK506 binding protein 1 (GP:21535744) [Arabidopsis thaliana] Length = 217 Score = 78.6 bits (185), Expect = 4e-15 Identities = 46/99 (46%), Positives = 61/99 (61%), Gaps = 11/99 (11%) Frame = +1 Query: 412 KGDLLHMHYTGTLDDGTEFDSSIPRGNPLTFKLGSGQVIKGWDQGLLG------MCEGEQ 573 +G L+++HYT DGT FDSS R PLT ++G G+VI+G DQG+LG M G + Sbjct: 111 RGVLVNIHYTARFADGTLFDSSYKRARPLTMRIGVGKVIRGLDQGILGGEGVPPMRVGGK 170 Query: 574 RKLVIPPELAYG--SAG---APPKIPKSATLTFHVELVK 675 RKL IPP+LAYG AG IP +ATL + + V+ Sbjct: 171 RKLQIPPKLAYGPEPAGCFSGDCNIPGNATLLYDINFVE 209 >At3g12340.1 68416.m01538 immunophilin, putative / FKBP-type peptidyl-prolyl cis-trans isomerase, putative contains Pfam profile: PF00254, FKBP-type peptidyl-prolyl cis-trans isomerases Length = 694 Score = 76.6 bits (180), Expect = 2e-14 Identities = 41/89 (46%), Positives = 55/89 (61%), Gaps = 1/89 (1%) Frame = +1 Query: 412 KGDLLHMHYTGTLDD-GTEFDSSIPRGNPLTFKLGSGQVIKGWDQGLLGMCEGEQRKLVI 588 KG + + YTG L D G FDS++ +PL F+LG VI+G G+ GM G++R+L+I Sbjct: 605 KGKKVSILYTGKLKDTGNLFDSNLGE-DPLRFRLGGENVIEGLSIGVEGMRVGDKRRLII 663 Query: 589 PPELAYGSAGAPPKIPKSATLTFHVELVK 675 PP L Y G K+PKSA L + VE VK Sbjct: 664 PPALGYSKRGLKEKVPKSAWLVYEVEAVK 692 >At5g05420.1 68418.m00584 immunophilin, putative / FKBP-type peptidyl-prolyl cis-trans isomerase, putative contains similarity to peptidyl-prolyl cis-trans isomerase Length = 143 Score = 75.8 bits (178), Expect = 3e-14 Identities = 42/91 (46%), Positives = 57/91 (62%), Gaps = 1/91 (1%) Frame = +1 Query: 403 KSRKGDLLHMHYTGTLD-DGTEFDSSIPRGNPLTFKLGSGQVIKGWDQGLLGMCEGEQRK 579 K+ G + +HYTG L +G FDS++ + F+L +G+VIKG D GL GM G +RK Sbjct: 52 KAEPGKRVSVHYTGKLQGNGKIFDSTVGKSR-YKFRLDAGKVIKGLDVGLNGMLVGGKRK 110 Query: 580 LVIPPELAYGSAGAPPKIPKSATLTFHVELV 672 L IPPE+ YG+ GA IP + L F VEL+ Sbjct: 111 LTIPPEMGYGAEGA-GSIPPDSWLVFDVELL 140 >At3g55520.1 68416.m06165 immunophilin, putative / FKBP-type peptidyl-prolyl cis-trans isomerase, putative POSSIBLE PEPTIDYL-PROLYL CIS-TRANS ISOMERASE) (EC 5.2.1.8) (PPIASE) (ROTAMASE) SP:P30416(Mouse);P59 PROTEIN (HSP BINDING IMMUNOPHILIN), rabbit, SWISSPROT:P27124:FKB4_RABBIT Length = 190 Score = 75.8 bits (178), Expect = 3e-14 Identities = 39/85 (45%), Positives = 51/85 (60%), Gaps = 1/85 (1%) Frame = +1 Query: 421 LLHMHYTGTL-DDGTEFDSSIPRGNPLTFKLGSGQVIKGWDQGLLGMCEGEQRKLVIPPE 597 ++ +HY G L +D FD++ +F+LG+G VI+ WD L M GE K+ PE Sbjct: 34 VVDVHYEGILAEDEKVFDTTREDNLVFSFELGTGSVIRSWDIALKTMKVGEVAKITCKPE 93 Query: 598 LAYGSAGAPPKIPKSATLTFHVELV 672 AYG AG+PP IP ATL F VELV Sbjct: 94 YAYGRAGSPPDIPPDATLIFEVELV 118 >At2g43560.1 68415.m05412 immunophilin / FKBP-type peptidyl-prolyl cis-trans isomerase family protein identical to Probable FKBP-type peptidyl-prolyl cis-trans isomerase 2, chloroplast precursor (Ppiase) (Rotamase) (SP:O22870)[Arabidopsis thaliana]; contains Pfam PF00254: peptidyl-prolyl cis-trans isomerase, FKBP-type Length = 223 Score = 66.5 bits (155), Expect = 2e-11 Identities = 35/83 (42%), Positives = 51/83 (61%), Gaps = 4/83 (4%) Frame = +1 Query: 433 HYTGTLDDGTEFDSSIPRGNPLTFKLGSGQVIKGWDQGLLGMCEGEQRKLVIPPELAY-- 606 +Y + G FDSS+ +G P F++GSGQVIKG D+G+L M G +R+L IP LA+ Sbjct: 130 NYVAMVPSGQIFDSSLEKGLPYLFRVGSGQVIKGLDEGILSMKAGGKRRLYIPGPLAFPK 189 Query: 607 GSAGAP--PKIPKSATLTFHVEL 669 G AP P++ ++ + F V L Sbjct: 190 GLVSAPGRPRVAPNSPVIFDVSL 212 >At5g64350.1 68418.m08082 FK506-binding protein (FKBP12) / immunophilin identical to immunophilin (GI:2104957) [Arabidopsis thaliana] Length = 112 Score = 60.1 bits (139), Expect = 2e-09 Identities = 35/95 (36%), Positives = 53/95 (55%), Gaps = 5/95 (5%) Frame = +1 Query: 403 KSRKGDLLHMHYTGTLDDGT---EFDSSIPRGN-PLTFKLGSGQVIKGWDQGLLGMCEGE 570 K G + +H TG DG +F S+ G P +F++G G VIKGWD+G++GM GE Sbjct: 15 KPAPGQTVTVHCTGFGKDGDLSQKFWSTKDEGQKPFSFQIGKGAVIKGWDEGVIGMQIGE 74 Query: 571 QRKLVIPPELAYGSAGAPP-KIPKSATLTFHVELV 672 +L + AYG+ G P I ++ L F +E++ Sbjct: 75 VARLRCSSDYAYGAGGFPAWGIQPNSVLDFEIEVL 109 >At3g10060.1 68416.m01206 immunophilin, putative / FKBP-type peptidyl-prolyl cis-trans isomerase, putative Pfam:PF-254: FKBP-type peptidyl-prolyl cis-trans isomerases Length = 230 Score = 56.4 bits (130), Expect = 2e-08 Identities = 35/94 (37%), Positives = 49/94 (52%), Gaps = 7/94 (7%) Frame = +1 Query: 412 KGDLLHMHYTGTLDDGTEFDS----SIPRGNPLTFKLGS---GQVIKGWDQGLLGMCEGE 570 KG + +HY T S + G P F +G G V+KG D G+ GM G Sbjct: 122 KGSRVAVHYVAKWKGITFMTSRQGLGVGGGTPYGFDVGQSERGNVLKGLDLGVEGMRVGG 181 Query: 571 QRKLVIPPELAYGSAGAPPKIPKSATLTFHVELV 672 QR +++PPELAYG G +IP +AT+ +EL+ Sbjct: 182 QRLVIVPPELAYGKKGV-QEIPPNATIELDIELL 214 >At3g60370.1 68416.m06752 immunophilin / FKBP-type peptidyl-prolyl cis-trans isomerase family protein SP:Q9M222; similar to FKBP-type peptidyl-prolyl cis-trans isomerase fkpA precursor (PPiase) (Rotamase)(SP:Q8X880) [Escherichia coli O157:H7] ; contains Pfam PF00254: peptidyl-prolyl cis-trans isomerase, FKBP-type Length = 242 Score = 51.6 bits (118), Expect = 5e-07 Identities = 20/64 (31%), Positives = 38/64 (59%) Frame = +1 Query: 409 RKGDLLHMHYTGTLDDGTEFDSSIPRGNPLTFKLGSGQVIKGWDQGLLGMCEGEQRKLVI 588 + G + HY G + G DS+ +G+P ++G+ ++ G++ G+ M G +R+++I Sbjct: 136 KDGQQVTFHYIGYNESGRRIDSTYIQGSPARIRMGTNALVPGFEMGIRDMKPGGRRRIII 195 Query: 589 PPEL 600 PPEL Sbjct: 196 PPEL 199 >At3g54010.2 68416.m05972 peptidyl-prolyl cis-trans isomerase, putative / FK506-binding protein, putative / pasticcino 1-D (PAS1-D) nearly identical to pasticcino 1-D [Arabidopsis thaliana] GI:3080740 Length = 545 Score = 49.2 bits (112), Expect = 3e-06 Identities = 33/110 (30%), Positives = 56/110 (50%), Gaps = 4/110 (3%) Frame = +1 Query: 355 KKLQIGIKKRPEDCSIKSRKGDLLHMHYTGTL--DDGTEF-DSSIPRGN-PLTFKLGSGQ 522 ++++ G + P DC ++ + L +HY G L ++ T F DS I + PL F G G Sbjct: 184 RRIRDGRGEFPMDCPLQDSR---LSVHYKGMLLNEEKTVFYDSKIDNNDQPLEFSSGEGL 240 Query: 523 VIKGWDQGLLGMCEGEQRKLVIPPELAYGSAGAPPKIPKSATLTFHVELV 672 V +G++ M GE + PP+ AY PP + + A + + +EL+ Sbjct: 241 VPEGFEMCTRLMLPGEIALVTCPPDYAYDKFPRPPGVSEGAHVQWEIELL 290 Score = 28.7 bits (61), Expect = 4.3 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 4/60 (6%) Frame = +1 Query: 523 VIKGWDQGLLGMCEGEQRKLVIPPELAYGS----AGAPPKIPKSATLTFHVELVKNXKEK 690 +I G +G+ M +GE + PE+ Y AP PK L F +EL+ K K Sbjct: 1 MILGLLEGIPTMHKGEIAMFKMKPEMHYAEIDCPVSAPENFPKDDELHFEIELLDFSKAK 60 >At3g54010.1 68416.m05971 peptidyl-prolyl cis-trans isomerase, putative / FK506-binding protein, putative / pasticcino 1-D (PAS1-D) nearly identical to pasticcino 1-D [Arabidopsis thaliana] GI:3080740 Length = 635 Score = 49.2 bits (112), Expect = 3e-06 Identities = 33/110 (30%), Positives = 56/110 (50%), Gaps = 4/110 (3%) Frame = +1 Query: 355 KKLQIGIKKRPEDCSIKSRKGDLLHMHYTGTL--DDGTEF-DSSIPRGN-PLTFKLGSGQ 522 ++++ G + P DC ++ + L +HY G L ++ T F DS I + PL F G G Sbjct: 274 RRIRDGRGEFPMDCPLQDSR---LSVHYKGMLLNEEKTVFYDSKIDNNDQPLEFSSGEGL 330 Query: 523 VIKGWDQGLLGMCEGEQRKLVIPPELAYGSAGAPPKIPKSATLTFHVELV 672 V +G++ M GE + PP+ AY PP + + A + + +EL+ Sbjct: 331 VPEGFEMCTRLMLPGEIALVTCPPDYAYDKFPRPPGVSEGAHVQWEIELL 380 Score = 39.9 bits (89), Expect = 0.002 Identities = 32/100 (32%), Positives = 45/100 (45%), Gaps = 8/100 (8%) Frame = +1 Query: 415 GDLLHMHYTGTLDDGTEFDS----SIPRGNPLTFKLGSGQVIKGWDQGLLGMCEGEQRKL 582 GD + H T DG +S S RG P+ LG+ ++I G +G+ M +GE Sbjct: 51 GDQVIYHCTVRTLDGVVVESTRSESGGRGVPIRDVLGNSKMILGLLEGIPTMHKGEIAMF 110 Query: 583 VIPPELAYGS----AGAPPKIPKSATLTFHVELVKNXKEK 690 + PE+ Y AP PK L F +EL+ K K Sbjct: 111 KMKPEMHYAEIDCPVSAPENFPKDDELHFEIELLDFSKAK 150 >At4g19830.1 68417.m02907 immunophilin / FKBP-type peptidyl-prolyl cis-trans isomerase family protein similar to 70 kDa peptidylprolyl isomerase (Peptidylprolyl cis-trans isomerase) (PPiase) (Rotamase) (SP:Q43207) [Triticum aestivum]; FKBP-type peptidyl-prolyl cis-trans isomerase,Synechocystis sp., PIR2:S75144; contains Pfam PF00254: peptidyl-prolyl cis-trans isomerase, FKBP-type Length = 229 Score = 45.2 bits (102), Expect = 5e-05 Identities = 29/83 (34%), Positives = 40/83 (48%), Gaps = 8/83 (9%) Frame = +1 Query: 412 KGDLLHMHYTGTL--DDGTEFDSSIPRGN------PLTFKLGSGQVIKGWDQGLLGMCEG 567 +GD + +HY G L G FDS+ + P TF LGS +VI G + + M G Sbjct: 104 EGDQIEIHYYGRLAAKQGWRFDSTYDHKDSNGEAVPFTFVLGSSKVIPGIETAVRSMKVG 163 Query: 568 EQRKLVIPPELAYGSAGAPPKIP 636 R++VIPP Y + P P Sbjct: 164 GIRRVVIPPSQGYQNTSQEPLPP 186 >At5g13410.1 68418.m01544 immunophilin / FKBP-type peptidyl-prolyl cis-trans isomerase family protein SP:Q9LYR5; similar to FK506-binding protein (Peptidyl-prolyl cis-trans isomerase) (PPiase) (Rotamase) (SP:P25138) [{Neisseria meningitidis]; peptidyl-prolyl cis-trans isomerase, Spodoptera frugiperda, EMBL:SF15038; contains Pfam PF00254: peptidyl-prolyl cis-trans isomerase, FKBP-type Length = 256 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = +1 Query: 502 FKLGSGQVIKGWDQGLLGMCEGEQRKLVIPPELAY 606 F LGS +VI +++ + GM G R++++PPEL Y Sbjct: 175 FTLGSNEVIPAFEEAVSGMALGGIRRIIVPPELGY 209 >At4g26555.1 68417.m03826 immunophilin / FKBP-type peptidyl-prolyl cis-trans isomerase family protein similar to FK506-binding protein (Peptidyl-prolyl cis-trans isomerase) (PPiase) (Rotamase) (SP:P25138) [{Neisseria meningitidis]; contains Pfam profile: PF00254 FKBP-type peptidyl-prolyl cis-trans isomerases; similar to FK506-binding protein 39 kDa (Peptidyl-prolyl cis-trans isomerase) (PPiase) (EC 5.2.1.8) (SP:O74191) {Schizosaccharomyces pombe} Length = 207 Score = 37.1 bits (82), Expect = 0.012 Identities = 20/72 (27%), Positives = 39/72 (54%), Gaps = 4/72 (5%) Frame = +1 Query: 403 KSRKGDLLHMHYTGTLDDGTEFDSSIPR----GNPLTFKLGSGQVIKGWDQGLLGMCEGE 570 ++ +GDL+ ++Y +G S++ + +P+ L VI+G + L+GM G Sbjct: 100 EAHEGDLVELNYVCRRANGYFVHSTVDQFSGESSPVKLILDENDVIEGLKEVLVGMKAGG 159 Query: 571 QRKLVIPPELAY 606 +R+ +IPP + Y Sbjct: 160 KRRALIPPSVGY 171 >At1g20810.1 68414.m02606 immunophilin / FKBP-type peptidyl-prolyl cis-trans isomerase family protein identical to Probable FKBP-type peptidyl-prolyl cis-trans isomerase 1, chloroplast precursor (Ppiase) (Rotamase) (SP:Q9LM71)[Arabidopsis thaliana]; similar to SP|P25138 FK506-binding protein (Peptidyl-prolyl cis-trans isomerase) (PPiase) (EC 5.2.1.8) (Rotamase) {Neisseria meningitidis}; contains Pfam PF00254: peptidyl-prolyl cis-trans isomerase, FKBP-type Length = 232 Score = 35.9 bits (79), Expect = 0.029 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +1 Query: 553 GMCEGEQRKLVIPPELAYGSAGAPPKIPKSATLTFHVELVK 675 GM G +R +++PPE YG G +IP AT ++EL++ Sbjct: 185 GMKVGGKRTVIVPPEAGYGQKGM-NEIPPGATFELNIELLR 224 >At3g21640.1 68416.m02729 FKBP-type peptidyl-prolyl cis-trans isomerase family protein similar to rof1 [Arabidopsis thaliana] GI:1354207; contains Pfam profile: PF00254 FKBP-type peptidyl-prolyl cis-trans isomerases Length = 365 Score = 35.1 bits (77), Expect = 0.050 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 4/101 (3%) Frame = +1 Query: 403 KSRKGDLLHMHYTG-TLDDGTEFDSSIPRGNPLTFKLGSGQV-IKGWDQGLLGMCEGEQR 576 K K +HY T + +F+ + P+ LG + + G G+ M GE+ Sbjct: 63 KPSKYSTCFLHYRAWTKNSQHKFEDTWHEQQPIELVLGKEKKELAGLAIGVASMKSGERA 122 Query: 577 KLVIPPELAYGSAG--APPKIPKSATLTFHVELVKNXKEKD 693 + + ELAYG G + P +P A L + VE++ + K+ Sbjct: 123 LVHVGWELAYGKEGNFSFPNVPPMADLLYEVEVIGFDETKE 163 >At5g55370.1 68418.m06899 long-chain-alcohol O-fatty-acyltransferase family protein / wax synthase family protein contains similarity to wax synthase similarity to wax synthase wax synthase - Simmondsia chinensis, PID:g5020219 similar to wax synthase [gi:5020219] from Simmondsia chinensis Length = 343 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -3 Query: 597 FRWNDKFTLFSFAHSK*PLIPTLNNLTR 514 F W F LF FA + PL P +NLTR Sbjct: 66 FTWLANFKLFLFAFDQEPLSPLPSNLTR 93 >At5g66310.1 68418.m08360 kinesin motor family protein contains Pfam domain, PF00225: Kinesin motor domain Length = 1063 Score = 28.3 bits (60), Expect = 5.7 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -1 Query: 431 ICKRSPLRLLMEQSSGLFLMPICSFFEAVLSITTNLNINIRIS 303 IC SP R+ +EQS L C+ +TTN +N+ +S Sbjct: 316 ICTMSPARIHVEQSRNTLLFASCA-----KEVTTNAQVNVVMS 353 >At4g24170.1 68417.m03468 kinesin motor family protein contains Pfam domain, PF00225: Kinesin motor domain Length = 1004 Score = 27.9 bits (59), Expect = 7.6 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = -1 Query: 431 ICKRSPLRLLMEQSSGLFLMPICSFFEAVLSITTNLNINIRIS 303 IC SP R +EQS L C+ +TTN +N+ +S Sbjct: 300 ICTMSPARSHLEQSRNTLLFATCA-----KEVTTNAQVNLVVS 337 >At1g68910.1 68414.m07886 expressed protein similar to Myosin heavy chain, nonmuscle type B (Cellular myosin heavy chain, type B) (Nonmuscle myosin heavy chain-B) (NMMHC-B) (Swiss-Prot:Q27991) [Bos taurus]; contains 1 transmembrane domain Length = 627 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 373 IKKRPEDCSIKSRKGDLLHMHYTGTLDDGTEFDSSI 480 +K + EDC+++ DLL GT+ + +E S + Sbjct: 275 LKSKLEDCTVQLEAKDLLVQKLEGTISENSEIVSEV 310 >At4g39110.1 68417.m05538 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 878 Score = 27.5 bits (58), Expect = 10.0 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +1 Query: 436 YTGTLDDGTEFDSSIPRGNP 495 Y GTLDDGT+ ++ RGNP Sbjct: 541 YIGTLDDGTKV--AVKRGNP 558 >At3g51150.1 68416.m05601 kinesin motor family protein contains Pfam domain, PF00225: Kinesin motor domain Length = 1025 Score = 27.5 bits (58), Expect = 10.0 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -1 Query: 431 ICKRSPLRLLMEQSSGLFLMPICSFFEAVLSITTNLNINIRIS 303 IC SP R+ +EQS L C+ +TTN +N+ +S Sbjct: 315 ICTLSPARVHVEQSRNTLLFASCA-----KEVTTNAQVNVVMS 352 >At2g21480.1 68415.m02556 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 871 Score = 27.5 bits (58), Expect = 10.0 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +1 Query: 436 YTGTLDDGTEFDSSIPRGNP 495 Y GT+DDGT+ +I RGNP Sbjct: 540 YIGTIDDGTQV--AIKRGNP 557 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,166,502 Number of Sequences: 28952 Number of extensions: 236055 Number of successful extensions: 516 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 511 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1653386488 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -