BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11a18 (712 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0990 - 13028011-13028114,13028182-13028554,13029488-130296... 28 6.4 05_07_0093 - 27648656-27648736,27649034-27649147,27649229-276492... 28 8.4 >03_02_0990 - 13028011-13028114,13028182-13028554,13029488-13029631, 13030389-13030396,13030634-13030711,13030968-13031132, 13031414-13031471 Length = 309 Score = 28.3 bits (60), Expect = 6.4 Identities = 22/91 (24%), Positives = 35/91 (38%) Frame = +1 Query: 196 YTQLSNTYTPSKNIPCNQLATAQNYVASNNQYQPLISSINPNEIVKVILSRVLTSPHVHR 375 Y ++TP+ + C+Q A Y S + S + PN VK R P Sbjct: 83 YAFFKPSWTPNTTVTCDQEYQALAYPWSAKETPAYSSMMLPN--VKDYKGRTWLLPLAAY 140 Query: 376 VEVPEVKPQHNPDAKEPINTNVPHVVNNYFI 468 + P Q P + N PH N++++ Sbjct: 141 LYNPWSTQQTKPAVRSDFNNYPPHSSNHHWM 171 >05_07_0093 - 27648656-27648736,27649034-27649147,27649229-27649288, 27649464-27649687,27649799-27649886,27650326-27650532, 27650566-27650784,27650903-27651001,27651439-27651504, 27651654-27651737,27651829-27651888,27652041-27652325, 27652789-27652836,27652988-27653034,27653442-27653556, 27653958-27654032,27654227-27654298,27654944-27656124, 27656613-27656757 Length = 1089 Score = 27.9 bits (59), Expect = 8.4 Identities = 17/74 (22%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +1 Query: 199 TQLSNTYTPSKNIPCNQLATAQNYVASNNQYQPLISSINPNEIVKVILSRVLTSPHVHR- 375 +Q ++T P+ + ++ + + + Q + LISS P + K +S L +P + Sbjct: 96 SQSASTEAPTSKVDASEESESTQSPKPSEQGETLISSTEP-PVSKAEVSEQLATPKTPKS 154 Query: 376 VEVPEVKPQHNPDA 417 + E KP H+ ++ Sbjct: 155 LSATEEKPSHSTES 168 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,623,635 Number of Sequences: 37544 Number of extensions: 206865 Number of successful extensions: 417 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 412 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 417 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1839213168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -