BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11a17 (756 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 26 0.44 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 23 4.1 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 25.8 bits (54), Expect = 0.44 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = +2 Query: 380 VLMLLQTLAGVGPIYNWVRHHRLHHAHFATEN--DPFDYNQGFAYAHIFTRMRKLSPYQ 550 ++ML TL G+G +YN + F + DP N G A ++ +R + +PYQ Sbjct: 370 IVMLTLTLPGIGVVYNG-DEIGMEDRWFTYQETVDPAGCNAGPAKYYLKSRDPERTPYQ 427 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 22.6 bits (46), Expect = 4.1 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +2 Query: 416 PIYNWVRHHRLHHAHFATENDPF 484 PIY HH LHH + P+ Sbjct: 68 PIYQ--SHHHLHHHQVLYQQSPY 88 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,432 Number of Sequences: 438 Number of extensions: 3931 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -