BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11a07 (520 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 23 2.5 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 3.3 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 5.7 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 5.7 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 5.7 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 5.7 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 5.7 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 21 7.6 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 21 7.6 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 21 7.6 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 21 7.6 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 22.6 bits (46), Expect = 2.5 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +3 Query: 186 YRRKFKKGQEEE 221 YRR FKK QEE+ Sbjct: 259 YRRNFKKMQEEK 270 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.2 bits (45), Expect = 3.3 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 33 GLCAYSGYKIYPGHGKTMVKVDGKTFTFLNSKCE 134 G C Y + PG K+ K+D F F + +CE Sbjct: 134 GTCLY----VPPGIFKSTCKIDITWFPFDDQRCE 163 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -3 Query: 176 PCYFTRIPPHQMGGFTF*IQE 114 P Y+ PP MG F IQE Sbjct: 351 PVYYGNFPPRPMGPFVS-IQE 370 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -3 Query: 176 PCYFTRIPPHQMGGFTF*IQE 114 P Y+ PP MG F IQE Sbjct: 351 PVYYGNFPPRPMGPFVS-IQE 370 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -3 Query: 176 PCYFTRIPPHQMGGFTF*IQE 114 P Y+ PP MG F IQE Sbjct: 351 PVYYGNFPPRPMGPFVS-IQE 370 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -3 Query: 176 PCYFTRIPPHQMGGFTF*IQE 114 P Y+ PP MG F IQE Sbjct: 351 PVYYGNFPPRPMGPFVS-IQE 370 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 5.7 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -3 Query: 176 PCYFTRIPPHQMGGFTF*IQE 114 P Y+ PP MG F IQE Sbjct: 340 PVYYGNFPPRPMGPFVS-IQE 359 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.0 bits (42), Expect = 7.6 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -3 Query: 176 PCYFTRIPPHQMGGF 132 P Y+ PP MG F Sbjct: 118 PVYYGNFPPRPMGPF 132 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.0 bits (42), Expect = 7.6 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -3 Query: 176 PCYFTRIPPHQMGGF 132 P Y+ PP MG F Sbjct: 118 PVYYGNFPPRPMGPF 132 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.0 bits (42), Expect = 7.6 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -3 Query: 176 PCYFTRIPPHQMGGF 132 P Y+ PP MG F Sbjct: 118 PVYYGNFPPRPMGPF 132 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.0 bits (42), Expect = 7.6 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -3 Query: 176 PCYFTRIPPHQMGGF 132 P Y+ PP MG F Sbjct: 118 PVYYGNFPPRPMGPF 132 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,222 Number of Sequences: 438 Number of extensions: 2112 Number of successful extensions: 19 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14477538 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -