BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11a06 (419 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0955 + 29168771-29170507 29 2.0 07_03_0744 + 21121757-21122202,21122316-21122737,21122992-211231... 28 2.7 11_06_0768 + 27129007-27129038,27129140-27129220,27129723-271300... 28 3.5 03_02_0599 - 9730204-9730314,9730766-9731549,9731631-9732051,973... 28 3.5 07_03_1792 + 29569623-29569737,29569848-29569981,29570117-295702... 27 4.6 11_01_0450 - 3487464-3487844,3487883-3488268,3488883-3489033,348... 27 6.1 07_03_0749 + 21212463-21212911,21212976-21213305,21213336-212134... 27 8.1 >03_05_0955 + 29168771-29170507 Length = 578 Score = 28.7 bits (61), Expect = 2.0 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +1 Query: 136 QQTVRRYHGESHFKPPTMDELPVPKGSWQSHHDANQR 246 QQ +R+H H PP + P Q HH +Q+ Sbjct: 26 QQQQQRHHHHHHLPPPPPPQSMAPHHHQQKHHHHHQQ 62 >07_03_0744 + 21121757-21122202,21122316-21122737,21122992-21123117, 21123198-21123319,21123413-21123623,21123955-21124192, 21124284-21124431,21124547-21124879 Length = 681 Score = 28.3 bits (60), Expect = 2.7 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 247 DVGWHHGATAMSLWALVIHPW 185 DVGW + A A L ALV H W Sbjct: 163 DVGWFNAAVAKILAALVEHTW 183 >11_06_0768 + 27129007-27129038,27129140-27129220,27129723-27130089, 27130165-27130255,27130515-27130595,27130764-27131830, 27132060-27132071,27132465-27133209,27133210-27135244, 27135712-27135787,27135925-27136029,27137080-27137166 Length = 1592 Score = 27.9 bits (59), Expect = 3.5 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +2 Query: 113 AKLHLGSSNKQCVATMAKVTSSPPPWMNYQCP 208 A L G+ + Q T A S PPPW NY P Sbjct: 249 AILPWGAKHAQQHGTNAPKQSVPPPWFNYWHP 280 >03_02_0599 - 9730204-9730314,9730766-9731549,9731631-9732051, 9732139-9732385,9733730-9733921,9734071-9734204, 9734316-9734477,9736162-9736200,9737507-9737825 Length = 802 Score = 27.9 bits (59), Expect = 3.5 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = -1 Query: 272 PKRSTALKRRWLASWCDCHEPLGTGNSSMVGGLK*LSP 159 P R LK W W CH G+G+ S + K P Sbjct: 199 PIRKNELKNLWQHVWRRCHSSSGSGSESGIRTQKCTKP 236 >07_03_1792 + 29569623-29569737,29569848-29569981,29570117-29570284, 29572817-29573003,29573098-29573422,29573591-29574368, 29574897-29575022 Length = 610 Score = 27.5 bits (58), Expect = 4.6 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -1 Query: 272 PKRSTALKRRWLASWCDCHEPLGTGNSS 189 P R LK W W CH G+G+ S Sbjct: 64 PIRKNELKNLWQHVWRRCHSSSGSGSES 91 >11_01_0450 - 3487464-3487844,3487883-3488268,3488883-3489033, 3489132-3491102,3492090-3492149,3492240-3492436, 3492678-3492963 Length = 1143 Score = 27.1 bits (57), Expect = 6.1 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +2 Query: 182 PPWMNYQCPKAHGSR 226 PPW + PKAHG+R Sbjct: 1096 PPWSQEEDPKAHGAR 1110 >07_03_0749 + 21212463-21212911,21212976-21213305,21213336-21213436, 21213758-21213883,21213962-21214083,21214177-21214450, 21214767-21215004,21215101-21215248,21215400-21215732 Length = 706 Score = 26.6 bits (56), Expect = 8.1 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 247 DVGWHHGATAMSLWALVIHPW 185 +VGW + A A L ALV H W Sbjct: 174 EVGWFNAAVAKILAALVEHAW 194 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,973,994 Number of Sequences: 37544 Number of extensions: 206111 Number of successful extensions: 554 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 554 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 766563072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -