BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov11a03 (634 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0401 - 23819230-23819829,23822612-23823194,23823303-23824027 31 0.76 11_01_0038 - 284152-284202,285014-285091,285215-285218,285669-28... 30 1.3 07_01_0770 + 5912412-5912476,5913759-5913779,5914015-5914638,591... 29 2.3 12_01_0036 - 299140-299190,300001-300078,300202-300205,300657-30... 29 4.1 10_08_0683 - 19860777-19861070,19861677-19861874,19862498-198626... 29 4.1 06_01_0839 + 6365962-6366798 28 5.4 10_08_0587 - 19012451-19013095 28 7.1 >03_05_0401 - 23819230-23819829,23822612-23823194,23823303-23824027 Length = 635 Score = 31.1 bits (67), Expect = 0.76 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -3 Query: 269 SVSPSQPKDRLSTSPACRGIFRCPPVP 189 S P+QP LS+SPA RG R P P Sbjct: 608 SAQPAQPATGLSSSPAARGHLRAHPPP 634 >11_01_0038 - 284152-284202,285014-285091,285215-285218,285669-285769, 286642-287151,287550-288032,288668-289156 Length = 571 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +2 Query: 92 AVSPRHVPRYSDLDEEDQHLFRAAYDTPSYDHEEQEDNEIS 214 A SP V Y DL E+D F+ D D E+ +D E S Sbjct: 4 ASSPASVQDYPDLQEDDDDDFQDDDDLDDEDEEDDDDQEPS 44 >07_01_0770 + 5912412-5912476,5913759-5913779,5914015-5914638, 5915264-5915439,5915526-5916124 Length = 494 Score = 29.5 bits (63), Expect = 2.3 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = +2 Query: 41 YSITMIVKLVIGIL-FLNAVSPRHVPRYSDLDEED-QHLFRAAYD 169 + + +V L+IGIL +L A PR +P LD++D + L A+ D Sbjct: 200 FIMVALVSLIIGILVYLYATDPRKIPGNHLLDDDDYERLHLASKD 244 >12_01_0036 - 299140-299190,300001-300078,300202-300205,300657-300757, 301636-302145,302552-303034,303672-304163 Length = 572 Score = 28.7 bits (61), Expect = 4.1 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 92 AVSPRHVPRYSDLDEEDQHLFRAAYDTPSYDHEEQEDNE 208 A SP V Y DL E+D F+ D D +E++D++ Sbjct: 4 ASSPASVQDYPDLQEDDDDDFQDDDDDDLDDEDEEDDDQ 42 >10_08_0683 - 19860777-19861070,19861677-19861874,19862498-19862659, 19862763-19862911,19863089-19863236,19863317-19863385, 19863471-19863719,19863937-19864131,19864444-19864560, 19864978-19866537 Length = 1046 Score = 28.7 bits (61), Expect = 4.1 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +2 Query: 410 QPTPSHPQYEQYAGPQYGAPQ-HGYDPYY 493 QP P PQ+ Y PQ P + YDPY+ Sbjct: 74 QPYPPPPQHHAYPPPQPHPPSPYVYDPYH 102 >06_01_0839 + 6365962-6366798 Length = 278 Score = 28.3 bits (60), Expect = 5.4 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -3 Query: 503 ISGRSTGRSRAGVRRIEVQHTVRIVDATALADSDNKSSFCRHL 375 + GR G +RAG++R+ + + A A AD D S C L Sbjct: 55 LRGRLRG-TRAGIKRLATSTSQALRQAAAAADDDESVSSCSKL 96 >10_08_0587 - 19012451-19013095 Length = 214 Score = 27.9 bits (59), Expect = 7.1 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -3 Query: 200 PPVPRDRSWECRMQLGTNVDLLRPNQNI*ARVLV 99 PPV + + +C +LG VD LR + ARV V Sbjct: 102 PPVAAEAAGDCASELGDGVDALRRCVDAMARVAV 135 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,261,911 Number of Sequences: 37544 Number of extensions: 300918 Number of successful extensions: 812 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 781 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 810 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1549385732 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -