BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10p23 (556 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1782.08c |rex3||exonuclease Rex3 |Schizosaccharomyces pombe|... 26 3.2 SPBC29A3.02c |his7||phosphoribosyl-AMP cyclohydrolase/phosphorib... 25 7.5 >SPAC1782.08c |rex3||exonuclease Rex3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 540 Score = 26.2 bits (55), Expect = 3.2 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +3 Query: 6 YCGNTFSILCHDATEEATREIRVLRVQTRGKETGN 110 Y G T HD+ E+A ++++ +T+ E+ N Sbjct: 506 YLGTTIQTSTHDSEEDAVSALQLVFYKTKSNESQN 540 >SPBC29A3.02c |his7||phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphohydrolase His7|Schizosaccharomyces pombe|chr 2|||Manual Length = 417 Score = 25.0 bits (52), Expect = 7.5 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +1 Query: 4 TIVATLSPSFVTMPPKKQPEK 66 ++V LS SF+T+ P ++P+K Sbjct: 172 SVVPVLSSSFLTVKPAEEPKK 192 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.303 0.122 0.341 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 723,324 Number of Sequences: 5004 Number of extensions: 6272 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 231978230 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 17 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 43 (21.8 bits)
- SilkBase 1999-2023 -