BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10p22 (647 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 25 2.7 AF269155-1|AAF91400.1| 59|Anopheles gambiae transcription fact... 23 6.3 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 23 8.3 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.6 bits (51), Expect = 2.7 Identities = 9/40 (22%), Positives = 20/40 (50%) Frame = +3 Query: 216 MQMHTNLTQREIDVLPPGTKTYESMARMFVQSDLEHIKQN 335 ++ T T+ ++ +PP + RM +Q + +KQ+ Sbjct: 229 LRFSTKPTELILECIPPKPSNLTQLLRMLIQRQIAFLKQH 268 >AF269155-1|AAF91400.1| 59|Anopheles gambiae transcription factor Deformed protein. Length = 59 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 387 RKVCLNHTLNESESNIRDLIQQKRMK 464 R++ + HTL SE I+ Q +RMK Sbjct: 30 RRIEIAHTLVLSERQIKIWFQNRRMK 55 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 23.0 bits (47), Expect = 8.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 291 ARMFVQSDLEHIKQNLR 341 A++FV DL H+K +R Sbjct: 224 AKLFVPVDLRHVKHEVR 240 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 596,721 Number of Sequences: 2352 Number of extensions: 11127 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -