BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10p19 (724 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY358236-1|AAQ88603.1| 183|Homo sapiens QCWQ6494 protein. 31 4.2 DQ020495-1|AAY84832.1| 754|Homo sapiens neuroblastoma apoptosis... 30 9.6 AB209038-1|BAD92275.1| 100|Homo sapiens ubiquitin carboxyl-term... 30 9.6 >AY358236-1|AAQ88603.1| 183|Homo sapiens QCWQ6494 protein. Length = 183 Score = 31.1 bits (67), Expect = 4.2 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = -1 Query: 175 SGRESSRRVTSVARPV-QRPSDVAGRRRPSHRAHATPATCWGGRVARGYPGTVPLRCP 5 SG + +++V VA + Q P P H +TC G R YP VP R P Sbjct: 114 SGPKVAKQVFQVAAELLQHPEHFVPSSVPEGCVHKPGSTCDGSLKGRAYPSCVPKRDP 171 >DQ020495-1|AAY84832.1| 754|Homo sapiens neuroblastoma apoptosis-related protease protein. Length = 754 Score = 29.9 bits (64), Expect = 9.6 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -3 Query: 89 APGPRDPSHMLGRSRCTRVPWHSPAALP 6 AP PR P +LG RC R+ H P LP Sbjct: 131 APEPRAPRDLLGCPRCRRL-LHKPVTLP 157 >AB209038-1|BAD92275.1| 100|Homo sapiens ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase) variant protein. Length = 100 Score = 29.9 bits (64), Expect = 9.6 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +3 Query: 27 PGYPRATRPPQHVAGVAWA-RCDGRRRPATSLG 122 P PR RPP AG A RC+ RRRP +G Sbjct: 59 PRAPRRGRPPVPAAGRDQAARCEHRRRPGWGVG 91 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,643,232 Number of Sequences: 237096 Number of extensions: 1766736 Number of successful extensions: 8093 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7860 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8090 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8511181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -