BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10p17 (629 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 5e-23 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 72 3e-13 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 57 1e-08 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 1e-08 SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 52 3e-07 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 50 1e-06 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 50 1e-06 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 49 3e-06 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 46 2e-05 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 44 1e-04 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 44 1e-04 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) 43 2e-04 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 41 0.001 SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) 40 0.002 SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) 38 0.007 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 38 0.009 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 36 0.021 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 36 0.027 SB_17696| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_51441| Best HMM Match : DEAD (HMM E-Value=4.9e-19) 35 0.063 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 32 0.44 SB_37968| Best HMM Match : DEAD (HMM E-Value=3.6) 31 1.0 SB_29752| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_28817| Best HMM Match : DEAD (HMM E-Value=3.4e-32) 30 1.8 SB_5719| Best HMM Match : Helicase_C (HMM E-Value=1e-24) 29 2.4 SB_20049| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-05) 29 3.1 SB_19313| Best HMM Match : 7tm_1 (HMM E-Value=9.1e-27) 29 3.1 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_49640| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 104 bits (250), Expect = 5e-23 Identities = 49/69 (71%), Positives = 59/69 (85%) Frame = +1 Query: 421 KFTALEGTVCEPTLLGIKDMGFITMTEIQAKAIPPLLEGRDLVGAAKTGSGKTLAFLIPA 600 +F+AL V E TL GIKDMGF TMTEIQ K+I PLL+GRDL+GAAKTGSGKTLAFL+P Sbjct: 571 EFSALSEDVSEKTLQGIKDMGFTTMTEIQHKSIAPLLKGRDLLGAAKTGSGKTLAFLVPV 630 Query: 601 IDLIYKLKF 627 ++L+YKL+F Sbjct: 631 VELLYKLQF 639 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 72.1 bits (169), Expect = 3e-13 Identities = 33/61 (54%), Positives = 46/61 (75%) Frame = +1 Query: 445 VCEPTLLGIKDMGFITMTEIQAKAIPPLLEGRDLVGAAKTGSGKTLAFLIPAIDLIYKLK 624 + + TL G+ GF+T T+IQ + IP L GRD++GAAKTGSGKTLAFLIP I+ +++ K Sbjct: 57 ISKRTLDGLMKAGFVTPTDIQKQGIPVALSGRDVLGAAKTGSGKTLAFLIPIIETLWRQK 116 Query: 625 F 627 + Sbjct: 117 W 117 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 56.8 bits (131), Expect = 1e-08 Identities = 24/42 (57%), Positives = 30/42 (71%) Frame = +1 Query: 478 MGFITMTEIQAKAIPPLLEGRDLVGAAKTGSGKTLAFLIPAI 603 MG TEIQ +PP+L+GRD +G AKTGSGKT AF +P + Sbjct: 25 MGIKKPTEIQLNCVPPILQGRDCIGCAKTGSGKTAAFALPIL 66 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 56.8 bits (131), Expect = 1e-08 Identities = 34/65 (52%), Positives = 41/65 (63%), Gaps = 2/65 (3%) Frame = +1 Query: 436 EGTVCEPTLL-GIKDMGFITMTEIQAKAIPP-LLEGRDLVGAAKTGSGKTLAFLIPAIDL 609 EG P +L + D GF T IQ+ +IPP LL RD++GAA+TGSGKTLAF IP I Sbjct: 133 EGLGVAPDILRALGDQGFSKPTPIQSLSIPPALLYHRDIIGAAETGSGKTLAFGIPIIQH 192 Query: 610 IYKLK 624 I K Sbjct: 193 IEAYK 197 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 55.6 bits (128), Expect = 3e-08 Identities = 25/51 (49%), Positives = 35/51 (68%) Frame = +1 Query: 451 EPTLLGIKDMGFITMTEIQAKAIPPLLEGRDLVGAAKTGSGKTLAFLIPAI 603 E + I+ + + T+IQ +A+P L GRD++G AKTGSGKT AFL PA+ Sbjct: 526 EQMMASIRKLEYTQPTQIQCQALPIALSGRDIIGIAKTGSGKTAAFLWPAL 576 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 52.4 bits (120), Expect = 3e-07 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 1/70 (1%) Frame = +1 Query: 412 SDQKFTALEGTVCEPTLLGIKDMGFITMTEIQAKAIPPLLEGRDLVGAAKTGSGKTLAFL 591 SD+ A + E + ++GF+ T IQA IP L G+D+ A TG+GKT AF+ Sbjct: 6 SDEVLNAYDSLDEEAEDRAVNELGFLHPTPIQASTIPVALMGKDVCACAATGTGKTAAFM 65 Query: 592 IPAID-LIYK 618 +P ++ L+Y+ Sbjct: 66 LPILERLLYR 75 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 50.4 bits (115), Expect = 1e-06 Identities = 22/49 (44%), Positives = 34/49 (69%) Frame = +1 Query: 460 LLGIKDMGFITMTEIQAKAIPPLLEGRDLVGAAKTGSGKTLAFLIPAID 606 L+GI + GF + IQ ++IP L GRD++ AK G+GKT A+L+P ++ Sbjct: 59 LMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKTAAYLVPLLE 107 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 50.4 bits (115), Expect = 1e-06 Identities = 22/49 (44%), Positives = 34/49 (69%) Frame = +1 Query: 460 LLGIKDMGFITMTEIQAKAIPPLLEGRDLVGAAKTGSGKTLAFLIPAID 606 L+GI + GF + IQ ++IP L GRD++ AK G+GKT A+L+P ++ Sbjct: 59 LMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGKTAAYLVPLLE 107 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 49.2 bits (112), Expect = 3e-06 Identities = 25/50 (50%), Positives = 35/50 (70%), Gaps = 1/50 (2%) Frame = +1 Query: 457 TLLGIKD-MGFITMTEIQAKAIPPLLEGRDLVGAAKTGSGKTLAFLIPAI 603 ++L I D +G+ T IQ +AIP L+ RD++G A+TGSGKT AF IP + Sbjct: 111 SILEIVDKLGYKDPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFAIPLL 160 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 48.4 bits (110), Expect = 5e-06 Identities = 21/56 (37%), Positives = 34/56 (60%) Frame = +1 Query: 451 EPTLLGIKDMGFITMTEIQAKAIPPLLEGRDLVGAAKTGSGKTLAFLIPAIDLIYK 618 E + I G+ T +Q A+P ++ GRDL+ A+TGSGKT A+++P + + K Sbjct: 488 EQLMANISRAGYRRPTPVQKAALPIVMAGRDLMACAQTGSGKTAAYMLPVLTSLIK 543 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 46.4 bits (105), Expect = 2e-05 Identities = 18/54 (33%), Positives = 34/54 (62%) Frame = +1 Query: 445 VCEPTLLGIKDMGFITMTEIQAKAIPPLLEGRDLVGAAKTGSGKTLAFLIPAID 606 + + T+ ++D G + IQA + +G D++G A+TG+GKTL+F +P ++ Sbjct: 80 ISQKTIDNLEDRGITYLFPIQASTFNYIYDGEDVIGQARTGTGKTLSFALPLVE 133 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 46.4 bits (105), Expect = 2e-05 Identities = 23/45 (51%), Positives = 29/45 (64%) Frame = +1 Query: 481 GFITMTEIQAKAIPPLLEGRDLVGAAKTGSGKTLAFLIPAIDLIY 615 G+ T +Q AIP + RDL+ A+TGSGKT AFLIP + IY Sbjct: 894 GYKKPTPVQKYAIPIVKGKRDLMACAQTGSGKTAAFLIPILSRIY 938 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 45.6 bits (103), Expect = 3e-05 Identities = 21/56 (37%), Positives = 34/56 (60%) Frame = +1 Query: 436 EGTVCEPTLLGIKDMGFITMTEIQAKAIPPLLEGRDLVGAAKTGSGKTLAFLIPAI 603 E + E L ++ + T +Q +IP ++ GRD++ A+TGSGKT AFL+P + Sbjct: 715 EANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMACAQTGSGKTAAFLLPVM 770 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = +1 Query: 454 PTLL-GIKDMGFITMTEIQAKAIPPLLEGRDLVGAAKTGSGKTLAFLIPAID 606 PTLL G+ + GF + IQ KAIP G DL+ AK+G+GKT F + A++ Sbjct: 22 PTLLRGLNEAGFEKPSPIQLKAIPLGRCGLDLIAQAKSGTGKTCVFSVIALE 73 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/43 (44%), Positives = 30/43 (69%) Frame = +1 Query: 484 FITMTEIQAKAIPPLLEGRDLVGAAKTGSGKTLAFLIPAIDLI 612 F T IQ +++ ++ GRD++G A+TGSGKTLA+ +P L+ Sbjct: 92 FQVPTPIQMQSLSCVMSGRDIIGLAETGSGKTLAYSLPLCMLL 134 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/44 (43%), Positives = 29/44 (65%) Frame = +1 Query: 481 GFITMTEIQAKAIPPLLEGRDLVGAAKTGSGKTLAFLIPAIDLI 612 GF + IQ +AI P+L+GRD++ A++G+GKT F I + I Sbjct: 16 GFEKPSAIQQRAIKPILKGRDVIAQAQSGTGKTATFSISVLQAI 59 >SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07) Length = 456 Score = 42.7 bits (96), Expect = 2e-04 Identities = 21/45 (46%), Positives = 26/45 (57%) Frame = +1 Query: 478 MGFITMTEIQAKAIPPLLEGRDLVGAAKTGSGKTLAFLIPAIDLI 612 +G T +Q P LL GRD+ G A GSGK LA+L+P I I Sbjct: 205 LGVTVPTSLQKHMWPSLLRGRDVAGVAIEGSGKRLAYLLPIIHQI 249 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 42.7 bits (96), Expect = 2e-04 Identities = 17/32 (53%), Positives = 25/32 (78%) Frame = +1 Query: 511 KAIPPLLEGRDLVGAAKTGSGKTLAFLIPAID 606 K +P +++G+D+V A+TGSGKT AFLIP + Sbjct: 310 KTLPLVMDGKDVVAMARTGSGKTAAFLIPMFE 341 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/45 (37%), Positives = 29/45 (64%) Frame = +1 Query: 469 IKDMGFITMTEIQAKAIPPLLEGRDLVGAAKTGSGKTLAFLIPAI 603 +K MG IQ KA+P + + L+ ++TG+GK+L FL+P++ Sbjct: 175 LKKMGITKPVPIQEKALPSVFSHKSLLIKSETGTGKSLVFLLPSV 219 >SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) Length = 475 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +1 Query: 451 EPTLL-GIKDMGFITMTEIQAKAIPPLLEGRDLVGAAKTGSGKTLAFLIPAI 603 +P LL I D GF +E+Q + IP + G D++ AK+G GKT F++ + Sbjct: 55 KPELLRAIVDCGFEHPSEVQHECIPQAILGMDIICQAKSGMGKTAVFVLATL 106 >SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +1 Query: 451 EPTLL-GIKDMGFITMTEIQAKAIPPLLEGRDLVGAAKTGSGKTLAFLIPAI 603 +P LL I D GF +E+Q + IP + G D++ AK+G GKT F++ + Sbjct: 55 KPELLRAIVDCGFEHPSEVQHECIPQAILGMDIICQAKSGMGKTAVFVLATL 106 >SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31) Length = 978 Score = 37.9 bits (84), Expect = 0.007 Identities = 17/36 (47%), Positives = 24/36 (66%) Frame = +1 Query: 496 TEIQAKAIPPLLEGRDLVGAAKTGSGKTLAFLIPAI 603 T IQ IP ++ ++ AA+TGSGKTLA+L P + Sbjct: 402 TVIQMVTIPKIIHRHHVICAAQTGSGKTLAYLAPLV 437 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 37.5 bits (83), Expect = 0.009 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = +1 Query: 469 IKDMGFITMTEIQAKAIPPLLEGRDLVGAAKTGSGKTL 582 + + G+ + T IQ + +P LL GRD++ A TGSGK L Sbjct: 211 LSNHGYHSPTPIQMQVLPVLLSGRDVMVCASTGSGKLL 248 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 36.3 bits (80), Expect = 0.021 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = +1 Query: 436 EGTVCEPTLLGIKDMGFITMTEIQAKAIPPLLEGRDLVGAAKTGSGKT 579 E + E L ++ + T +Q +IP ++ GRD++ A+TGSGKT Sbjct: 138 EANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMACAQTGSGKT 185 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 35.9 bits (79), Expect = 0.027 Identities = 17/51 (33%), Positives = 32/51 (62%), Gaps = 2/51 (3%) Frame = +1 Query: 466 GIKDMGFITMTEIQAKAIPPLLEGR--DLVGAAKTGSGKTLAFLIPAIDLI 612 G+ DMGF ++IQ A+P LL +++ +++G+GKT AF++ + + Sbjct: 117 GVYDMGFNKPSKIQETALPMLLADPPVNMIAQSQSGTGKTAAFVLTMLSRV 167 >SB_17696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 35.9 bits (79), Expect = 0.027 Identities = 21/45 (46%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Frame = +1 Query: 436 EGTVCEPTLL-GIKDMGFITMTEIQAKAIPP-LLEGRDLVGAAKT 564 EG P +L + D GF T IQ+ +IPP LL RD++GAA+T Sbjct: 75 EGLGVAPDILRALGDQGFSKPTPIQSLSIPPALLYHRDIIGAAET 119 >SB_51441| Best HMM Match : DEAD (HMM E-Value=4.9e-19) Length = 304 Score = 34.7 bits (76), Expect = 0.063 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +1 Query: 481 GFITMTEIQAKAIPPLLEGRDLVGAAKTGSGKTLAFLIPAI 603 G+I +Q +AI LL +D + TG+GKT+ + IPA+ Sbjct: 136 GYIDFRPMQRQAIDTLLAEKDSLILLPTGAGKTICYAIPAL 176 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 31.9 bits (69), Expect = 0.44 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +1 Query: 538 RDLVGAAKTGSGKTLAFLIPAIDLI 612 +D++G A+TGSGKT AF +P + + Sbjct: 2 KDVIGLAETGSGKTGAFALPILQAL 26 >SB_37968| Best HMM Match : DEAD (HMM E-Value=3.6) Length = 127 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 579 CFSRASFGSTHKIPAFQQRRYSFSLN 502 CF+ A G++H++ AFQ RR LN Sbjct: 84 CFAGAGLGASHQVAAFQHRRDRLLLN 109 >SB_29752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1281 Score = 30.3 bits (65), Expect = 1.3 Identities = 14/37 (37%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = +1 Query: 496 TEIQAKAIPPLLEGR-DLVGAAKTGSGKTLAFLIPAI 603 +E+Q +A + +GR D+ + TGSGK+L + +PA+ Sbjct: 20 SELQQRACETVSKGRQDVFVSMPTGSGKSLCYQLPAV 56 >SB_28817| Best HMM Match : DEAD (HMM E-Value=3.4e-32) Length = 651 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 490 TMTEIQAKAIPPLLEGRDLVGAAKTGSGKTLAFLIPAI 603 T +Q + I + G D + TG GK+L F +PA+ Sbjct: 89 TFRHLQLECINATMSGVDCILIMPTGGGKSLCFQLPAV 126 >SB_5719| Best HMM Match : Helicase_C (HMM E-Value=1e-24) Length = 1366 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +1 Query: 478 MGFITMTEIQAKAIPPLLEGRDLVGAAKTGSGKTLAFLIPA 600 +GF + Q +A+ +L G + TG+GK+L + +PA Sbjct: 520 LGFSSFRAGQEQAVMRILSGMSSLVVLSTGAGKSLCYQLPA 560 >SB_20049| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-05) Length = 1023 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/21 (61%), Positives = 17/21 (80%), Gaps = 1/21 (4%) Frame = +2 Query: 515 LYLLCWKAGILWVLPKL-ALE 574 + LLCW G+L+VLP+L ALE Sbjct: 891 IILLCWIGGLLYVLPQLIALE 911 >SB_19313| Best HMM Match : 7tm_1 (HMM E-Value=9.1e-27) Length = 545 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/21 (61%), Positives = 17/21 (80%), Gaps = 1/21 (4%) Frame = +2 Query: 515 LYLLCWKAGILWVLPKL-ALE 574 + LLCW G+L+VLP+L ALE Sbjct: 139 IILLCWIGGLLYVLPQLIALE 159 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 469 IKDMGFITMTEIQAKAIPPLLEGRDLVGAAKT 564 +K + T IQA+AIP ++ GRD++ T Sbjct: 120 LKKNSYEKPTPIQAQAIPVIMSGRDMIAIVMT 151 >SB_49640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1177 Score = 28.3 bits (60), Expect = 5.4 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = +1 Query: 538 RDLVGAAKTGSGKTLAFLIPAIDLIYK 618 R LV A TGSGKT+ F + I LI K Sbjct: 351 RPLVVCAPTGSGKTVIFELAIIRLIMK 377 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 27.9 bits (59), Expect = 7.2 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = +1 Query: 526 LLEGRDLVGAAKTGSGKTLAF---LIPAIDLIYKLK 624 +L RD++ A++G+GKT F ++ ID YK K Sbjct: 119 VLSARDVIAQAQSGTGKTATFAISILQEIDTNYKDK 154 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,978,634 Number of Sequences: 59808 Number of extensions: 211215 Number of successful extensions: 620 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 589 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 618 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1572561250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -