BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10p16 (676 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4G9.05 |mpf1||meiotic PUF family protein 1|Schizosaccharomyc... 25 10.0 SPAC19A8.02 |||transcriptional coactivator |Schizosaccharomyces ... 25 10.0 SPAC22H10.10 |alp21|sto1|tubulin specific chaperone cofactor E|S... 25 10.0 >SPAC4G9.05 |mpf1||meiotic PUF family protein 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 581 Score = 25.0 bits (52), Expect = 10.0 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = -3 Query: 275 LTH*ASTSLRQMK*KLDIHLRNTPNLYLFFSSHCIQPFAFTLSRNLK 135 LT + +L+ + L + L N NL +S C++P + + NLK Sbjct: 77 LTLRRTPALKLLPETLSVELSNEVNLTSSTTSSCVKPSPYLTNCNLK 123 >SPAC19A8.02 |||transcriptional coactivator |Schizosaccharomyces pombe|chr 1|||Manual Length = 1213 Score = 25.0 bits (52), Expect = 10.0 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +2 Query: 485 GVKWLLKPIEIKNNLQRKCR 544 G++W++KP I ++ +CR Sbjct: 907 GLEWIVKPFAISKVIEAECR 926 >SPAC22H10.10 |alp21|sto1|tubulin specific chaperone cofactor E|Schizosaccharomyces pombe|chr 1|||Manual Length = 511 Score = 25.0 bits (52), Expect = 10.0 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -3 Query: 374 N*ITSNIKHYVPHFNESQMRHCGFRSHD-QMVT 279 N I+SN +PH + + CG S D Q +T Sbjct: 181 NFISSNTVLLIPHLTQLSVNGCGLNSKDVQWIT 213 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,628,576 Number of Sequences: 5004 Number of extensions: 51110 Number of successful extensions: 110 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 309878492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -