BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10p16 (676 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15855| Best HMM Match : BNR (HMM E-Value=1.5) 31 0.64 SB_39672| Best HMM Match : Peptidase_M20 (HMM E-Value=9.9e-09) 30 2.0 >SB_15855| Best HMM Match : BNR (HMM E-Value=1.5) Length = 287 Score = 31.5 bits (68), Expect = 0.64 Identities = 21/47 (44%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = -2 Query: 558 SRCGGRHLR--CRLFLISMGFSNHLTPAGLHASPPVILAIKKNCKGK 424 S CG R LR CR F + + FS+H LHA P A K + KGK Sbjct: 173 SSCGVRVLRKTCRSFYMHVSFSSHKMHETLHARQP--KASKIHLKGK 217 >SB_39672| Best HMM Match : Peptidase_M20 (HMM E-Value=9.9e-09) Length = 702 Score = 29.9 bits (64), Expect = 2.0 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 4/52 (7%) Frame = -1 Query: 157 LRYREI*---NDFNLTNV-KTTRFILFLFNSLLCFSIVTY*VSNSYNLIIKI 14 LRYR + D+N T + K FIL F+ + +VT+ V N+Y+L+I++ Sbjct: 401 LRYRTVAWGPGDYNRTELLKFKEFILREFSYVFHHPLVTFEVINNYSLLIQV 452 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,906,354 Number of Sequences: 59808 Number of extensions: 357371 Number of successful extensions: 633 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 603 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 633 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -