BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10p14 (667 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5903| Best HMM Match : No HMM Matches (HMM E-Value=.) 270 7e-73 SB_33584| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 8e-12 SB_33442| Best HMM Match : AAA (HMM E-Value=0) 65 6e-11 SB_35973| Best HMM Match : zf-CCHC (HMM E-Value=0.0026) 52 3e-07 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 46 3e-05 SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.030 SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.068 SB_23205| Best HMM Match : Helicase_C (HMM E-Value=3.9e-14) 34 0.090 SB_12331| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0) 32 0.37 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 32 0.48 SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_21400| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_52977| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) 30 1.5 SB_28977| Best HMM Match : AAA (HMM E-Value=0) 30 1.9 SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) 29 2.6 SB_30566| Best HMM Match : zf-C4_Topoisom (HMM E-Value=0.38) 29 2.6 SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) 29 3.4 SB_53343| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_35649| Best HMM Match : M (HMM E-Value=6e-09) 29 3.4 SB_21874| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_36974| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 29 4.5 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_41890| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 28 5.9 SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) 28 5.9 SB_10355| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0037) 28 5.9 SB_46136| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_56573| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_41319| Best HMM Match : NACHT (HMM E-Value=5.2e-14) 28 7.9 SB_32475| Best HMM Match : IWS1_C (HMM E-Value=0) 28 7.9 SB_29265| Best HMM Match : OmpH (HMM E-Value=3) 28 7.9 SB_4879| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_5903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 270 bits (662), Expect = 7e-73 Identities = 145/188 (77%), Positives = 153/188 (81%), Gaps = 1/188 (0%) Frame = +1 Query: 85 MATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQND 264 MA TLEDK+IW DGEE + EEVLRM TDEIVSR RLLDNEI Sbjct: 1 MAATLEDKAIWGDGEE-MGEEVLRMSTDEIVSRARLLDNEI------------------- 40 Query: 265 KIKENTEKIKVNKTLPYLVSNVIELLDVDPQE-EEEDGAVVDLDSQRKGKCAVIKTSTRQ 441 KEN+EKIKVNKTLPYLVSNVIELLDVDPQ+ EEDGA VDLDSQRKGKCAVIKTSTRQ Sbjct: 41 --KENSEKIKVNKTLPYLVSNVIELLDVDPQDYAEEDGANVDLDSQRKGKCAVIKTSTRQ 98 Query: 442 TYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGG 621 TYFLPVIGLV+ E L PGDLVGVNKDSYLILE LPAEYD+RVKAMEVDERPTEQYSDIGG Sbjct: 99 TYFLPVIGLVEPENLTPGDLVGVNKDSYLILEKLPAEYDSRVKAMEVDERPTEQYSDIGG 158 Query: 622 LDKQIXEL 645 LD+QI E+ Sbjct: 159 LDQQIQEM 166 >SB_33584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 455 Score = 67.7 bits (158), Expect = 8e-12 Identities = 43/152 (28%), Positives = 77/152 (50%) Frame = +1 Query: 211 IMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDL 390 +M+ E ++ L+ Q +K +E K+ + P V N+ E++D Sbjct: 268 LMEEEFIQNQERLKPQEEKHEEERSKVDDLRGTPMSVGNLEEIID--------------- 312 Query: 391 DSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVK 570 D+ A++ TS +++ ++ VD + L+PG V +N + ++ L + D V Sbjct: 313 DNH-----AIVSTSVGSEHYVSILSFVDKDLLEPGCTVLLNHKVHAVVGVLSDDADPMVT 367 Query: 571 AMEVDERPTEQYSDIGGLDKQIXELIEAVVLP 666 M++++ P E Y+DIGGLD QI E+ E+V LP Sbjct: 368 VMKLEKAPQESYADIGGLDTQIQEIKESVELP 399 >SB_33442| Best HMM Match : AAA (HMM E-Value=0) Length = 369 Score = 64.9 bits (151), Expect = 6e-11 Identities = 28/83 (33%), Positives = 51/83 (61%) Frame = +1 Query: 418 VIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPT 597 ++ ++T Y++ ++ +D E LKP V ++K S +++ LP E D+ + + +E+P Sbjct: 101 IVASTTGSNYYVRILSTIDKELLKPSASVALHKHSNALVDILPPEADSSIAMLTNEEKPN 160 Query: 598 EQYSDIGGLDKQIXELIEAVVLP 666 Y++IGG+D Q E+ EAV LP Sbjct: 161 VSYAEIGGMDIQKQEIREAVELP 183 >SB_35973| Best HMM Match : zf-CCHC (HMM E-Value=0.0026) Length = 779 Score = 52.4 bits (120), Expect = 3e-07 Identities = 29/83 (34%), Positives = 42/83 (50%) Frame = +1 Query: 418 VIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERPT 597 ++K + Y + VD KLK G V ++ + I+ LP E D V M ++ Sbjct: 72 IVKATNGPRYVVGCRRQVDKAKLKQGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGN 131 Query: 598 EQYSDIGGLDKQIXELIEAVVLP 666 YSD+GGL +QI EL E + LP Sbjct: 132 ISYSDVGGLSEQIRELREVIELP 154 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 46.0 bits (104), Expect = 3e-05 Identities = 23/53 (43%), Positives = 32/53 (60%) Frame = +1 Query: 508 VNKDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQIXELIEAVVLP 666 V+++ Y I LP + D V M+V+E+P YSDIGG +QI +L E V P Sbjct: 51 VDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDIGGCKEQIDKLREVVETP 103 >SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 42.3 bits (95), Expect = 3e-04 Identities = 32/101 (31%), Positives = 48/101 (47%), Gaps = 8/101 (7%) Frame = +1 Query: 388 LDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGD----LVGVNKDSYLILETLP--- 546 L++QR A ++ + L G E +KP D LV V+ + +++ Sbjct: 96 LEAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDIDKGID 155 Query: 547 -AEYDARVKAMEVDERPTEQYSDIGGLDKQIXELIEAVVLP 666 AE D V M V++ P Y +GGLDKQI E+ E + LP Sbjct: 156 MAEVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELP 196 >SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3212 Score = 35.9 bits (79), Expect = 0.030 Identities = 30/128 (23%), Positives = 60/128 (46%), Gaps = 2/128 (1%) Frame = +1 Query: 61 EKTNHNITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKI--MKSEVMR 234 +K+ I + L D W+D +L EV ++ D+ + +++D+E ++ ++S + + Sbjct: 2590 DKSTATIHLEVELSD---WKDQASSLQSEVAQLKKDKAAAMHKVIDSEEQMIQLRSRLYK 2646 Query: 235 ISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQRKGKC 414 L D +K + K N L + + L V E ++ +VD + + K KC Sbjct: 2647 TEDSLVRNQDTVKLLS---KENTDLRVEIERLRSRLSVYASETAKE--IVDGNGEGKAKC 2701 Query: 415 AVIKTSTR 438 V+ T T+ Sbjct: 2702 GVV-TKTK 2708 >SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 34.7 bits (76), Expect = 0.068 Identities = 20/84 (23%), Positives = 46/84 (54%), Gaps = 2/84 (2%) Frame = +1 Query: 166 DEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNK-TLPYLVSNVIELL 342 + + S R +NEI +K+ + R+ EL++ +++ ++EKI ++ + L ++ + Sbjct: 105 ESVTSELRGRENEIAELKTSIGRLESELRSLKSELQNSSEKISEDEHEISQLKNDKARCM 164 Query: 343 -DVDPQEEEEDGAVVDLDSQRKGK 411 ++ + E+ + VVDL RK + Sbjct: 165 QELRDEREKSNKLVVDLQKTRKAQ 188 >SB_23205| Best HMM Match : Helicase_C (HMM E-Value=3.9e-14) Length = 1197 Score = 34.3 bits (75), Expect = 0.090 Identities = 28/100 (28%), Positives = 47/100 (47%), Gaps = 4/100 (4%) Frame = +1 Query: 103 DKSIWEDGEEALSEEVLRMPT--DEIVSRTRLLDNEIKIMKSE--VMRISHELQAQNDKI 270 D+ WE+ ++ L M T DE + + E K E + + ++ AQ +I Sbjct: 391 DREEWEEEQKRLDRAWYDMDTGYDETQNPFADVSEEYTKKKEEKLIKKAVKKMSAQQRQI 450 Query: 271 KENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDL 390 ++ + + N+ L S V++ LDVD EEE+ A V L Sbjct: 451 NKDNDMWETNRML---TSGVVQKLDVDEDFEEENEAKVHL 487 >SB_12331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 748 Score = 33.1 bits (72), Expect = 0.21 Identities = 27/115 (23%), Positives = 51/115 (44%), Gaps = 3/115 (2%) Frame = +1 Query: 70 NHNITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHEL 249 N NIT E I +DG+E E++ PT + +L DN ++ E +L Sbjct: 585 NMNITFKAHREVNRIEQDGQEVQEEQLEDNPTVPLGQEEQLEDNPTVPLEQE-----EQL 639 Query: 250 QAQNDKIKENTEKIKVNKTLPYLVSNVIE---LLDVDPQEEEEDGAVVDLDSQRK 405 + E ++++ N T+P +E + ++ +E+ ED V L+ + + Sbjct: 640 EDNPTVPLEQEQQLEDNPTVPLEQEEQLEDNPTVPLEQEEQLEDNPTVPLEQEEQ 694 >SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1040 Score = 33.1 bits (72), Expect = 0.21 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +1 Query: 223 EVMRISHELQAQNDKIKENTEKIK-VNKTLPYLVSNVIELLD 345 E+ + +EL+ Q + IKEN EK+K K + L +IEL D Sbjct: 612 EITELENELEEQREIIKENEEKLKEKEKEIEKLKKKIIELSD 653 >SB_15301| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 590 Score = 32.3 bits (70), Expect = 0.37 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 3/58 (5%) Frame = +1 Query: 193 LDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVI---ELLDVDPQ 357 ++NE K+ ++ V ++H+L + D E E I++ PY + +V+ EL+ V P+ Sbjct: 191 VENEEKVYEALVRWVNHDLSQRRDLFPELLELIRLPLVSPYYLVDVVEKEELMTVSPR 248 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 31.9 bits (69), Expect = 0.48 Identities = 25/107 (23%), Positives = 54/107 (50%), Gaps = 2/107 (1%) Frame = +1 Query: 97 LEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKE 276 + ++ + E+ E EE +++ + + E+++M + + HE + +++IKE Sbjct: 2909 ISEEELLEEVEVQRVEEGASHDLEDVPALKESYEEEVEVM---AVGLKHEERVNDEEIKE 2965 Query: 277 NTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDL--DSQRKGK 411 EKI +++ N+I+ L+ +EE E AV + +R+GK Sbjct: 2966 KDEKIHLDE------ENIIQDLEETFEEELEVSAVETSKNEDERRGK 3006 >SB_53556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1524 Score = 30.7 bits (66), Expect = 1.1 Identities = 25/98 (25%), Positives = 47/98 (47%), Gaps = 2/98 (2%) Frame = +1 Query: 118 EDGEEALSEEVL--RMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKI 291 EDG E L E++ R E+ R + L+ E +++ +V + ++ + KIK+ EK+ Sbjct: 408 EDGTE-LEEKIRSQRNRITELERRVKELEKEKNLLEQQVKTMKNKSDDDDKKIKDLNEKV 466 Query: 292 KVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQRK 405 +V + L N E+ + E + + DL + K Sbjct: 467 RVLE--KQLKENDAEIQGLKDDNERLEDELEDLSTTIK 502 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 1/68 (1%) Frame = +1 Query: 166 DEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLD 345 DE++ + L ++ ++ EV ++ EL+ + ++TEK+ N + ++EL Sbjct: 716 DELMKQNESLRKKVSKLEDEVRFLNDELREADSSSIKDTEKL--NAEIREFKKKIVELEK 773 Query: 346 -VDPQEEE 366 VD QEEE Sbjct: 774 LVDDQEEE 781 >SB_21400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1531 Score = 30.7 bits (66), Expect = 1.1 Identities = 30/109 (27%), Positives = 48/109 (44%), Gaps = 9/109 (8%) Frame = +1 Query: 142 EEVLRMPTDEIVSR---TRLLDNEIKIMKSEVMRISHELQAQND------KIKENTEKIK 294 EE LR +E+ R LDNE+ ++++ +L+ D ++ E E+ K Sbjct: 909 EEKLRRTEEELKDRDGQVAKLDNELTKLQNDFQDTITQLKTLEDLLDTSKRVVEEKEQ-K 967 Query: 295 VNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQRKGKCAVIKTSTRQ 441 V + L +V EL D +E+DG + +LD K IK Q Sbjct: 968 VTELDKLLNESVDELQQKDKSLKEKDGKLAELDQALKESRKEIKNREAQ 1016 >SB_52977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 929 Score = 30.7 bits (66), Expect = 1.1 Identities = 30/136 (22%), Positives = 62/136 (45%), Gaps = 1/136 (0%) Frame = +1 Query: 238 SHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVV-DLDSQRKGKC 414 S + + K +E++E + + + ++ E + + +EEEED ++ D D K Sbjct: 363 SEDEEKPEHKPREDSEDVTSRTSSDFTLATESEEEEEEEEEEEEDDELIGDPDVLEALKT 422 Query: 415 AVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPAEYDARVKAMEVDERP 594 A R+ L ++ DA+ + D + +D ++ ++P Y+ K + ++ P Sbjct: 423 A----KARENEDLLLLA-ADADGNEESDYT-ITEDEGSVVSSIPTFYEGEQKLEDDEDEP 476 Query: 595 TEQYSDIGGLDKQIXE 642 T + S LD+Q E Sbjct: 477 TSRTST--ALDEQPSE 490 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = +1 Query: 265 KIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGAVVDLDSQR 402 K+K ++ + NKT + N +E D +P+E EED V D++R Sbjct: 510 KLKSKMKRSEKNKTEELVAVNKVETDDDNPEETEEDSGNVS-DTER 554 >SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) Length = 2478 Score = 30.3 bits (65), Expect = 1.5 Identities = 45/199 (22%), Positives = 80/199 (40%), Gaps = 9/199 (4%) Frame = +1 Query: 37 LLNLKDYYEKTNHN-ITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKI 213 L+NL+ K + T LE + E L++ L M + + L+N ++ Sbjct: 791 LVNLQSLQNKLERSEFETRTRLEGQVEALQKESNLAKRQLEMDNTHHKNLIKTLENRVQE 850 Query: 214 MKSEVMRISHELQAQNDKIKENTEKI--------KVNKTLPYLVSNVIELLDVDPQEEEE 369 +++++ S Q D + NT+++ +V L V ELL +P ++ Sbjct: 851 LQTQIDTESRSNQQARDMLVRNTKEMERLEFKNTEVKAQLEAAEKRVHELLSKEPSSDQ- 909 Query: 370 DGAVVDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPA 549 D+D RK KT + T + L DAE K DL + + L E + Sbjct: 910 -----DIDKMRKETEEKFKTDLQDT----ELKLKDAE-AKIKDLETQLEQAKLHAEQFKS 959 Query: 550 EYDARVKAMEVDERPTEQY 606 A +A+ + TE++ Sbjct: 960 MSGANDEALREVNKSTEEF 978 >SB_28977| Best HMM Match : AAA (HMM E-Value=0) Length = 442 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +1 Query: 580 VDERPTEQYSDIGGLDKQIXELIEAVVLP 666 V E+P ++SDI GL+ L EAV+LP Sbjct: 88 VMEKPNVKWSDIAGLESAKEALKEAVILP 116 >SB_52106| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0098) Length = 1177 Score = 29.5 bits (63), Expect = 2.6 Identities = 23/91 (25%), Positives = 48/91 (52%), Gaps = 2/91 (2%) Frame = +1 Query: 28 VQELLNLKDYYEKTNHNIT--MATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDN 201 ++E L + +E T +++ +AT ++ K + EAL L+ ++ + L Sbjct: 185 LEEQLKAETQHESTLRDLSSQLATAVQQK----EELEALRARELKANREDYQKKCESLMV 240 Query: 202 EIKIMKSEVMRISHELQAQNDKIKENTEKIK 294 EI+ +KSEV +++ LQ Q D+++ + +K Sbjct: 241 EIESLKSEVQQLNSRLQNQ-DELETERKTLK 270 >SB_30566| Best HMM Match : zf-C4_Topoisom (HMM E-Value=0.38) Length = 597 Score = 29.5 bits (63), Expect = 2.6 Identities = 20/41 (48%), Positives = 23/41 (56%), Gaps = 4/41 (9%) Frame = +1 Query: 550 EYDARVKAMEVDERPTEQYSDIGGL---DKQ-IXELIEAVV 660 EYD R+KA E +QY D+ L DKQ I L EAVV Sbjct: 523 EYDKRIKAFEESGDKPQQYVDLTRLRCDDKQTIVALAEAVV 563 >SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) Length = 2122 Score = 29.1 bits (62), Expect = 3.4 Identities = 27/94 (28%), Positives = 46/94 (48%), Gaps = 14/94 (14%) Frame = +1 Query: 40 LNLKDYYEKTNHNITM-----ATTLEDKSIWED---GEEALSE---EVLRM---PTDEIV 177 LN KDY ++ N T+ LE+K + G + ++E E+ +M PT+ + Sbjct: 1593 LNNKDYIQQRTDNQTLRQENETVLLENKDLKAQIAAGLKKMAEYEREITKMGQRPTEVVK 1652 Query: 178 SRTRLLDNEIKIMKSEVMRISHELQAQNDKIKEN 279 R R D+EI+ E+ + EL+ Q ++EN Sbjct: 1653 RRGRRGDSEIQRENIELQKRIAELEIQRKSVEEN 1686 Score = 27.9 bits (59), Expect = 7.9 Identities = 18/75 (24%), Positives = 34/75 (45%), Gaps = 2/75 (2%) Frame = +1 Query: 49 KDYYEKTNHNITMATTLEDKS--IWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKS 222 +D YEK N + M +++ I + A + +L+ +E + + EIK ++S Sbjct: 1193 EDLYEKENEVVVMKKRVKEFELLISNSNDSAAKDSLLKTVKNE----NEIQEKEIKKLRS 1248 Query: 223 EVMRISHELQAQNDK 267 EV+ + E K Sbjct: 1249 EVLELQREASGAQGK 1263 >SB_53343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = +1 Query: 127 EEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEK 288 + A+ E++ D VS R+ +NE+++ KSE + +Q K + E+ Sbjct: 121 QTAIQLEIVNFNDDSFVSGNRMSNNEVRVTKSESLSSPSNSYSQAFKSNNSREE 174 >SB_35649| Best HMM Match : M (HMM E-Value=6e-09) Length = 1279 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 3/64 (4%) Frame = +1 Query: 94 TLEDKSIWED---GEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQND 264 +LE+K +D E S E DE+V R L +E+K +K E + ++++ N Sbjct: 682 SLEEKIRLKDVVIDELKTSLETCSKERDELVESNRNLGSELKALKKENEELVSQVESLNQ 741 Query: 265 KIKE 276 K+++ Sbjct: 742 KVEQ 745 >SB_21874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 608 Score = 29.1 bits (62), Expect = 3.4 Identities = 23/86 (26%), Positives = 38/86 (44%) Frame = +1 Query: 49 KDYYEKTNHNITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEV 228 K+ +KT N T E+K ++ ++ E + T E +T+ ++ K K + Sbjct: 458 KENKDKTKEN--KDKTKENKDKTKENKDKTKEN--KDKTKENKDKTKNNKDKTKENKDKT 513 Query: 229 MRISHELQAQNDKIKENTEKIKVNKT 306 + + DK KEN K K NKT Sbjct: 514 NENKDKTKENKDKTKENKNKTKENKT 539 >SB_36974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 634 Score = 28.7 bits (61), Expect = 4.5 Identities = 9/18 (50%), Positives = 16/18 (88%) Frame = +1 Query: 334 ELLDVDPQEEEEDGAVVD 387 +++D+ PQ+EEEDG V++ Sbjct: 527 DIVDLQPQDEEEDGEVIE 544 >SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1086 Score = 28.7 bits (61), Expect = 4.5 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +1 Query: 502 VGVN-KDSYLILETLPAEYDARVKAMEVDERPTEQYSDIGGLDKQIXELIEAVVLP 666 V +N KD L+ L A + + A ++ P + D+GGLD E+++ + LP Sbjct: 779 VSINFKDFQEALDALQASHADAIGAPKI---PDISWKDVGGLDSVKEEILDTIQLP 831 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 28.7 bits (61), Expect = 4.5 Identities = 9/18 (50%), Positives = 16/18 (88%) Frame = +1 Query: 334 ELLDVDPQEEEEDGAVVD 387 +++D+ PQ+EEEDG V++ Sbjct: 982 DIVDLQPQDEEEDGEVIE 999 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 28.7 bits (61), Expect = 4.5 Identities = 9/18 (50%), Positives = 16/18 (88%) Frame = +1 Query: 334 ELLDVDPQEEEEDGAVVD 387 +++D+ PQ+EEEDG V++ Sbjct: 22 DIVDLQPQDEEEDGEVIE 39 >SB_41890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.3 bits (60), Expect = 5.9 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +1 Query: 196 DNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIE 336 D +K + SE ++ EL Q DKI KIK+ P + ++IE Sbjct: 104 DQPMKKLGSEFETVTGELLTQLDKISRGVRKIKLVSGDPRDIQSLIE 150 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 28.3 bits (60), Expect = 5.9 Identities = 17/69 (24%), Positives = 30/69 (43%) Frame = +1 Query: 106 KSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTE 285 KS+ + G+ + DE+ R L+ E+K +KSE + Q N ++ Sbjct: 224 KSLKKGGDLLFPGASYKRKLDEVAGRLDELEREVKRLKSETCQTKMTCQPCNHQLLMVGP 283 Query: 286 KIKVNKTLP 312 + + TLP Sbjct: 284 TVPIPPTLP 292 >SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) Length = 2072 Score = 28.3 bits (60), Expect = 5.9 Identities = 23/96 (23%), Positives = 44/96 (45%) Frame = +1 Query: 1 DFRVVKCVWVQELLNLKDYYEKTNHNITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVS 180 D +K + +EL L + Y + + K E+ E+A++E+ R+ S Sbjct: 724 DMESIKVLHARELEKLSETYAGDRSRLLQ----DQKEATENHEQAMTEQRQRLE-----S 774 Query: 181 RTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEK 288 + L E MKS V ++ +++ Q +K+K E+ Sbjct: 775 QIEKLKEENGQMKSTVSGLASDVEMQRNKVKTLREQ 810 >SB_10355| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.0037) Length = 1127 Score = 28.3 bits (60), Expect = 5.9 Identities = 14/51 (27%), Positives = 27/51 (52%) Frame = +1 Query: 118 EDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKI 270 ++ E L + LR E S+ + LD+E+ + + ++ HELQ + +I Sbjct: 910 QEAEFELKLDDLRADIQERDSQIKELDSEMAEVTENIAKLQHELQGKGQEI 960 >SB_46136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 28.3 bits (60), Expect = 5.9 Identities = 16/63 (25%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = +1 Query: 157 MPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDK-IKENTEKIKVNKTLPYLVSNVI 333 M TD+ L+ ++ M SE++R+ + A++DK ++ E I+ L+ ++ Sbjct: 76 METDQANQSVSDLEGIVQSMGSEILRLQSLVSAEDDKMLRYKVENIRRKHNYIPLIMEML 135 Query: 334 ELL 342 +LL Sbjct: 136 KLL 138 >SB_56573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 641 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/46 (34%), Positives = 27/46 (58%) Frame = +1 Query: 112 IWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHEL 249 I E +E ++ R+ EI+S+T +L ++IK + VMRI E+ Sbjct: 196 IIEGKKEFKLADLGRVTLKEIISKTSVLVSDIKGSRESVMRIPMEI 241 >SB_41319| Best HMM Match : NACHT (HMM E-Value=5.2e-14) Length = 961 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +1 Query: 163 TDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVN 300 T+++V + +EI I E ++ HE++ + +I TEK+ V+ Sbjct: 376 TNKVVHEVKGKVSEISIKTDETNKVVHEVKGKVSEISIKTEKMAVD 421 >SB_32475| Best HMM Match : IWS1_C (HMM E-Value=0) Length = 768 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +1 Query: 274 ENTEKIKVNKTLPYLVSNVIELLDVDPQEEEEDGA 378 E ++ + ++T P N +E V P+ EEEDGA Sbjct: 56 EGEKEDEASETSPRGSENSVESRSVSPKNEEEDGA 90 >SB_29265| Best HMM Match : OmpH (HMM E-Value=3) Length = 218 Score = 27.9 bits (59), Expect = 7.9 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 4/50 (8%) Frame = +1 Query: 337 LLDVDPQEEE--EDGAVVDLDSQ--RKGKCAVIKTSTRQTYFLPVIGLVD 474 L D D E E +D VD++++ KGK K+S + Y PV+ L D Sbjct: 25 LCDTDAPEAEVVDDEPEVDVETETEEKGKAETKKSSEPEEYTPPVVALED 74 >SB_4879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 607 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +1 Query: 43 NLKDYYEKTNHNITMATTLEDKSIWEDGEEALSEEVLR 156 N + YE N + M + L+D E GEE EEV R Sbjct: 391 NNNNNYESDNSDTNMISDLDDDDDDESGEEEEEEEVNR 428 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.313 0.133 0.364 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,214,887 Number of Sequences: 59808 Number of extensions: 321510 Number of successful extensions: 818 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 747 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 816 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1717720750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -