BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10p13 (662 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16224| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_28087| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_15991| Best HMM Match : SCP (HMM E-Value=2.3e-23) 36 0.039 SB_23388| Best HMM Match : ParBc (HMM E-Value=0.3) 32 0.36 SB_51749| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_29199| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_38207| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_27260| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_26477| Best HMM Match : GST_C (HMM E-Value=0.97) 29 2.6 SB_52321| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_57025| Best HMM Match : Fascin (HMM E-Value=0) 29 3.4 SB_44976| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_58666| Best HMM Match : Vps16_C (HMM E-Value=6.4e-37) 29 4.5 SB_36803| Best HMM Match : RhoGAP (HMM E-Value=0) 29 4.5 SB_14837| Best HMM Match : UCH (HMM E-Value=1.10002e-42) 29 4.5 SB_40993| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_8158| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_54001| Best HMM Match : Macscav_rec (HMM E-Value=0.87) 28 5.9 SB_14118| Best HMM Match : Gemini_AC4_5 (HMM E-Value=2.1) 28 5.9 SB_20574| Best HMM Match : Extensin_2 (HMM E-Value=0.25) 28 5.9 SB_19791| Best HMM Match : Reprolysin (HMM E-Value=3.1) 28 5.9 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 28 5.9 SB_56915| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_40856| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_35419| Best HMM Match : SMC_C (HMM E-Value=1.9e-05) 28 7.8 SB_18596| Best HMM Match : ig (HMM E-Value=0.033) 28 7.8 SB_14894| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_53774| Best HMM Match : efhand (HMM E-Value=0.012) 28 7.8 SB_26044| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_15911| Best HMM Match : Sec7 (HMM E-Value=0) 28 7.8 SB_13196| Best HMM Match : VSP (HMM E-Value=1.4) 28 7.8 SB_2051| Best HMM Match : LicD (HMM E-Value=1.7e-07) 28 7.8 >SB_16224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1127 Score = 35.9 bits (79), Expect = 0.029 Identities = 31/112 (27%), Positives = 51/112 (45%), Gaps = 4/112 (3%) Frame = +2 Query: 56 TLDVXXXXXXKEASPTEDDPSTCTSEPSMSCDKKNPISEEIEEELQFHNDYFKTEREERI 235 +LD+ KEA E+D T +P + DKK + E + E + YF TER+ I Sbjct: 918 SLDLLNKIRKKEAKKLEED---LTRDPGL--DKKMTMRERLPELCRILKTYFTTERKAAI 972 Query: 236 SLNNSF----RSVRSAKTTEPSHSLDSTKTRHGSLRYDFKSSASLEQVSYRC 379 L ++ S ++ ++ P+ S + ++ FKS SL + RC Sbjct: 973 PLEDAVLKLSESYSTSLSSTPAFSWMHDSSVQNLVKAAFKSLKSLLRNRARC 1024 >SB_28087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1501 Score = 35.5 bits (78), Expect = 0.039 Identities = 23/64 (35%), Positives = 33/64 (51%) Frame = +1 Query: 130 RTEHELRQKESNIRRNRRRTAVPQRLLQDRERRTDQSK*FVPFSSFSENDRTESFARFD* 309 R E ELR+K + R RR+ A +RLL++ RR D+ + + R E RF+ Sbjct: 1173 RREDELRRKREDDDRGRRKLAEERRLLEEERRREDERR------REEDRKRLEDLKRFE- 1225 Query: 310 DEAR 321 DE R Sbjct: 1226 DEKR 1229 >SB_15991| Best HMM Match : SCP (HMM E-Value=2.3e-23) Length = 1189 Score = 35.5 bits (78), Expect = 0.039 Identities = 32/113 (28%), Positives = 56/113 (49%), Gaps = 5/113 (4%) Frame = +2 Query: 86 KEASPTEDDPSTCTSEPSMSCDKKNPISEEIEEELQFHNDY--FKTEREERISLNNS--F 253 +EA T+ D TC+ ++ D + EEIE++L FHNDY + R+ I L N+ + Sbjct: 253 EEAETTDQDTDTCSD---ITIDIGS--DEEIEQDLIFHNDYEIVRLARDHDIWLRNNKKY 307 Query: 254 RSVRS-AKTTEPSHSLDSTKTRHGSLRYDFKSSASLEQVSYRCLVNNNKVDKR 409 + + P L++ + R D S+A+ E++ +CL +N+ R Sbjct: 308 KKIHGRTMNLPPPPFLETLFAPLTNARVD--SAANEEELQKQCLDAHNEFRTR 358 >SB_23388| Best HMM Match : ParBc (HMM E-Value=0.3) Length = 1168 Score = 32.3 bits (70), Expect = 0.36 Identities = 11/45 (24%), Positives = 27/45 (60%) Frame = +2 Query: 149 DKKNPISEEIEEELQFHNDYFKTEREERISLNNSFRSVRSAKTTE 283 + + +SE ++++L+F KT +E+ + L + + ++ KTT+ Sbjct: 952 ESSSKVSENLQKKLEFERKRCKTYKEQAVKLKKLYEAEKNTKTTD 996 >SB_51749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +3 Query: 507 LRFSIKFAFPNIQVIPTCLFVTMHLVLCSVV 599 LRFS K A IQ +PTC VTM + C+ V Sbjct: 106 LRFSNKRAGVRIQRLPTCTPVTMPFISCTPV 136 >SB_29199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +3 Query: 507 LRFSIKFAFPNIQVIPTCLFVTMHLVLCSVV 599 LRFS K A IQ +PTC VTM + C+ V Sbjct: 70 LRFSNKRAGVRIQRLPTCTPVTMPFISCTPV 100 >SB_38207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 29.9 bits (64), Expect = 1.9 Identities = 25/104 (24%), Positives = 40/104 (38%), Gaps = 2/104 (1%) Frame = +2 Query: 116 STCTSEPSMSCDKKNPISEEIE--EELQFHNDYFKTEREERISLNNSFRSVRSAKTTEPS 289 S + P + D + P SE + E +H + E+ + N R A + P Sbjct: 90 SDAGTNPGYAPDSRPPPSEGAKRHEFATWHARGCSADLEKGVKSNEEGR----ASSQPPQ 145 Query: 290 HSLDSTKTRHGSLRYDFKSSASLEQVSYRCLVNNNKVDKRKVRY 421 HS H + S+ Q S RC ++ N+ D R R+ Sbjct: 146 HSFSDLSQSHRDTNIPYLPSSVHRQPSRRCRISLNRPDFRSRRH 189 >SB_27260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +3 Query: 507 LRFSIKFAFPNIQVIPTCLFVTMHLVLCSVV 599 LRFS K IQ +PTC VTM + C+ V Sbjct: 26 LRFSKKGPVVRIQRLPTCTPVTMPFISCTPV 56 >SB_26477| Best HMM Match : GST_C (HMM E-Value=0.97) Length = 971 Score = 29.5 bits (63), Expect = 2.6 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 1/81 (1%) Frame = +2 Query: 191 QFHNDYFKTEREERISLNNSFRSVRSAKTTEPSHSLDSTK-TRHGSLRYDFKSSASLEQV 367 + HN FK E L +S RS + + PSHS D ++ + ++ KS+ ++V Sbjct: 554 KLHNFEFKQSNECLAHLGHSARSGNNIRVYLPSHSADGSRPSDTWAITQREKSAEDWDEV 613 Query: 368 SYRCLVNNNKVDKRKVRYRSS 430 + R L+N V R SS Sbjct: 614 NLR-LINVAPVPDNSRRLDSS 633 >SB_52321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +3 Query: 507 LRFSIKFAFPNIQVIPTCLFVTMHLVLCSVV 599 +RFS K A IQ +PTC VT+ + C+ V Sbjct: 7 IRFSSKRARVRIQRLPTCTPVTLPFISCTPV 37 >SB_57025| Best HMM Match : Fascin (HMM E-Value=0) Length = 504 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 333 MTLRVPPRWSRSLIDASLITTKSIRGRYVTAVP 431 ++LR WS +D I KS GRY+TA P Sbjct: 274 VSLRKKQTWSLEQVDGEAIYLKSHLGRYLTADP 306 >SB_44976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 Query: 507 LRFSIKFAFPNIQVIPTCLFVTMHLVLCSVV 599 LRFS K IQ +PTC VT+ + C+ V Sbjct: 70 LRFSNKRPVVRIQRLPTCTPVTLRFISCTPV 100 >SB_58666| Best HMM Match : Vps16_C (HMM E-Value=6.4e-37) Length = 259 Score = 28.7 bits (61), Expect = 4.5 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 2/76 (2%) Frame = +2 Query: 122 CTSEPSMSCDKK-NPISEEI-EEELQFHNDYFKTEREERISLNNSFRSVRSAKTTEPSHS 295 C S+ M+ K N I +I EE+++ +D + E+E+ N+ S K E H Sbjct: 72 CLSDAKMNYTKAGNVIYTKITEEQMKLLDDQSRLEKEQHQEFKNTSLSDTIEKCIELGHL 131 Query: 296 LDSTKTRHGSLRYDFK 343 D+ K LR DFK Sbjct: 132 KDAEK-----LRKDFK 142 >SB_36803| Best HMM Match : RhoGAP (HMM E-Value=0) Length = 1277 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -3 Query: 162 GFFLSQLMLGSLVHVDGSSSVGEASFEL 79 G F+S++ GSLV DGS +VG+ E+ Sbjct: 139 GVFVSRITPGSLVDCDGSLAVGDEILEV 166 >SB_14837| Best HMM Match : UCH (HMM E-Value=1.10002e-42) Length = 1712 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +2 Query: 149 DKKNPISEEIEEELQFHNDYFKTEREERISLNNSFRSVRS--AKTTEPSHSLDSTK 310 +K+N +S E++ + + + K+E+E+ L N S A TE S+D K Sbjct: 87 EKQNRLSAELQAQEKLQIEKLKSEKEKSAQLVNGIESSSKTPAAITESKSSIDKNK 142 >SB_40993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 Query: 507 LRFSIKFAFPNIQVIPTCLFVTMHLVLCSVV 599 LRFS K IQ +PTC VT+ + C+ V Sbjct: 26 LRFSNKRTGVRIQRLPTCTPVTLPFISCTAV 56 >SB_8158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 395 Score = 28.7 bits (61), Expect = 4.5 Identities = 21/68 (30%), Positives = 31/68 (45%) Frame = +2 Query: 266 SAKTTEPSHSLDSTKTRHGSLRYDFKSSASLEQVSYRCLVNNNKVDKRKVRYRSSVTYSL 445 S K S L+STK + YD S + +S N K+D +RY ++V SL Sbjct: 60 SVKVPNGSLYLNSTKRIYRLYFYDNDSLWVCKNLSRSYTKENTKIDDVALRYLTAVCMSL 119 Query: 446 SLELSCFI 469 S+ F+ Sbjct: 120 SVISMSFL 127 >SB_54001| Best HMM Match : Macscav_rec (HMM E-Value=0.87) Length = 528 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 5/44 (11%) Frame = +3 Query: 474 FVIVNALCFVFLRFSIKFAFPNIQVIPT-----CLFVTMHLVLC 590 +V ++ LC+++ ++ I +P Q IPT L + HL+ C Sbjct: 318 YVSMDVLCYIWDQYVISIKYPKFQSIPTFAVALLLVLKTHLLAC 361 >SB_14118| Best HMM Match : Gemini_AC4_5 (HMM E-Value=2.1) Length = 345 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 525 FAFPNIQVIPTCLFVTMHLVLCSVVKCS 608 FA NI+ IP F+ + ++ CS+V CS Sbjct: 272 FATENIKAIPFVKFLMLKILDCSMVTCS 299 >SB_20574| Best HMM Match : Extensin_2 (HMM E-Value=0.25) Length = 1508 Score = 28.3 bits (60), Expect = 5.9 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 1/81 (1%) Frame = +2 Query: 134 PSMSCDKKNPISEEIEEELQFHNDYFKTEREERISLNNSFRSVRSAKTTEPSHSLDSTKT 313 PSMS + P+ + E H D ++TE R + + + +T P+H ST+ Sbjct: 1218 PSMS--SQWPVGDAYRTEGPTHGDAYRTEGPTRGAYRTEGPTHGAYRTEGPTHGY-STQQ 1274 Query: 314 RHGSLRYD-FKSSASLEQVSY 373 R + +D + S+ +E + Y Sbjct: 1275 RTSDISHDTYASNGRVEFLDY 1295 >SB_19791| Best HMM Match : Reprolysin (HMM E-Value=3.1) Length = 616 Score = 28.3 bits (60), Expect = 5.9 Identities = 23/70 (32%), Positives = 30/70 (42%), Gaps = 3/70 (4%) Frame = +2 Query: 257 SVRSAKTTEPSHSLDSTKTRHGSLRYDFKSSASLEQVSYRCLVNN---NKVDKRKVRYRS 427 S+ S EPS D + G L DF + VS CL+ N + +D+ K S Sbjct: 392 SLPSQVANEPSSLRDLKYSVSGILNADFYVRHTQSPVSRECLLQNEIRDLIDQDKYSIVS 451 Query: 428 SVTYSLSLEL 457 S Y LS L Sbjct: 452 SYEYFLSRNL 461 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 28.3 bits (60), Expect = 5.9 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 1/81 (1%) Frame = +2 Query: 134 PSMSCDKKNPISEEIEEELQFHNDYFKTEREERISLNNSFRSVRSAKTTEPSHSLDSTKT 313 PSMS + P+ + E H D ++TE R + + + +T P+H ST+ Sbjct: 615 PSMS--SQWPVGDAYRTEGPTHGDAYRTEGPTRGAYRTEGPTHGAYRTEGPTHGY-STQQ 671 Query: 314 RHGSLRYD-FKSSASLEQVSY 373 R + +D + S+ +E + Y Sbjct: 672 RTSDISHDTYASNGRVEFLDY 692 >SB_56915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 720 Score = 27.9 bits (59), Expect = 7.8 Identities = 16/71 (22%), Positives = 29/71 (40%) Frame = +2 Query: 119 TCTSEPSMSCDKKNPISEEIEEELQFHNDYFKTEREERISLNNSFRSVRSAKTTEPSHSL 298 TC E + +++E++E H + K EE+I + + S+R + + Sbjct: 515 TCNGELPSPRELSAALAKELQEFYVRHENKLKRVLEEKIIVEDDLESLRQEHAKKIEEAY 574 Query: 299 DSTKTRHGSLR 331 D K LR Sbjct: 575 DDLKKTQKELR 585 >SB_40856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 27.9 bits (59), Expect = 7.8 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +3 Query: 507 LRFSIKFAFPNIQVIPTCLFVTMHLVLCSVV 599 LRFS K A IQ + TC VTM + C+ V Sbjct: 7 LRFSSKRARVRIQRLSTCTPVTMPFISCTPV 37 >SB_35419| Best HMM Match : SMC_C (HMM E-Value=1.9e-05) Length = 867 Score = 27.9 bits (59), Expect = 7.8 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +1 Query: 124 YQRTEHELRQKESNIRRNRRRTA 192 +Q+ + ELRQ+E+NI N+R A Sbjct: 464 HQQLQDELRQQEANIAENKRELA 486 >SB_18596| Best HMM Match : ig (HMM E-Value=0.033) Length = 192 Score = 27.9 bits (59), Expect = 7.8 Identities = 11/45 (24%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +2 Query: 125 TSEPSMSCDKKNPISEEIEEELQFHNDYFKTEREE-RISLNNSFR 256 T +PS+ CD + + + + + D+ EE +S+ N F+ Sbjct: 143 TDKPSLKCDSRKSLKQTSQTPTTCNEDHLNARLEEFHVSITNRFQ 187 >SB_14894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1052 Score = 27.9 bits (59), Expect = 7.8 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = -3 Query: 162 GFFLSQLMLGSLVHVDGSSSVGEASFELELDETSRVSQSELT 37 G + S+ G +D SS + E +EL +DE + +S++T Sbjct: 690 GSYRSRFSSGVSSRLDSSSVITEDFYELPIDEDWEIDRSQIT 731 >SB_53774| Best HMM Match : efhand (HMM E-Value=0.012) Length = 918 Score = 27.9 bits (59), Expect = 7.8 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Frame = +2 Query: 86 KEASPTEDDPSTC-TSEPSMSCDKKNPISEEIEEE--LQFHNDYFKTEREERISLNNSFR 256 KE D TC +E + I E +E ++ FKT+RE+ +S + + Sbjct: 834 KEDDLNNKDKGTCPVTEKEKESHSASEIGEFSNKEDIIKLSEWDFKTKREDMVSDESHSK 893 Query: 257 SVRSAKT 277 S+R+A+T Sbjct: 894 SIRNAET 900 >SB_26044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 27.9 bits (59), Expect = 7.8 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 Query: 507 LRFSIKFAFPNIQVIPTCLFVTMHLVLCSVV 599 LRFS K IQ +PTC VT+ + C+ V Sbjct: 7 LRFSNKRPVVRIQRLPTCSPVTLPFISCTPV 37 >SB_15911| Best HMM Match : Sec7 (HMM E-Value=0) Length = 1220 Score = 27.9 bits (59), Expect = 7.8 Identities = 19/80 (23%), Positives = 34/80 (42%), Gaps = 3/80 (3%) Frame = +2 Query: 89 EASPTEDDPSTCTSEPSMSCDKKNPISEEI---EEELQFHNDYFKTEREERISLNNSFRS 259 ++S EDDP++CT+E + S +EE+ + + H + + E + S S Sbjct: 371 DSSVHEDDPNSCTAESTQSSAGDVKETEEVQYAQAQNSGHAENITSSLSEPPGESTSHMS 430 Query: 260 VRSAKTTEPSHSLDSTKTRH 319 + TE + S H Sbjct: 431 EHPEQDTEQAKDATSNSAEH 450 >SB_13196| Best HMM Match : VSP (HMM E-Value=1.4) Length = 500 Score = 27.9 bits (59), Expect = 7.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 521 KVCFSEHSSYSHMFVCDH 574 K CF EHS HM C H Sbjct: 93 KTCFHEHSEDGHMKTCTH 110 >SB_2051| Best HMM Match : LicD (HMM E-Value=1.7e-07) Length = 328 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -1 Query: 203 RCGTAVLLRFLRILDSFCRNSCSVRWYMSTGRL 105 RC VL R LRI D R++ +++++++G L Sbjct: 121 RCSQLVLTRMLRIFDQIARSN-GLKYWLTSGTL 152 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,554,580 Number of Sequences: 59808 Number of extensions: 361727 Number of successful extensions: 1403 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 1217 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1395 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -