BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10p13 (662 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y13592-1|CAA73920.1| 136|Anopheles gambiae voltage-gated sodium... 26 1.2 AY615653-1|AAU05110.1| 71|Anopheles gambiae sodium channel pro... 26 1.2 AY615652-1|AAU05109.1| 71|Anopheles gambiae sodium channel pro... 26 1.2 AY615651-1|AAU05108.1| 71|Anopheles gambiae sodium channel pro... 26 1.2 AY615650-1|AAU05107.1| 62|Anopheles gambiae sodium channel pro... 26 1.2 AY615649-1|AAU05106.1| 71|Anopheles gambiae sodium channel pro... 26 1.2 AY615648-1|AAU05105.1| 71|Anopheles gambiae sodium channel pro... 26 1.2 AY615647-1|AAU05104.1| 71|Anopheles gambiae sodium channel pro... 26 1.2 AY615646-1|AAU05103.1| 71|Anopheles gambiae sodium channel pro... 26 1.2 AY615628-1|AAU05085.1| 71|Anopheles gambiae sodium channel pro... 26 1.2 AY615618-1|AAU05075.1| 71|Anopheles gambiae sodium channel pro... 26 1.2 AY615617-1|AAU05074.1| 71|Anopheles gambiae sodium channel pro... 26 1.2 AY615616-1|AAU05073.1| 71|Anopheles gambiae sodium channel pro... 26 1.2 AY615615-1|AAU05072.1| 69|Anopheles gambiae sodium channel pro... 26 1.2 AY615614-1|AAU05071.1| 71|Anopheles gambiae sodium channel pro... 26 1.2 AY615612-1|AAU05069.1| 69|Anopheles gambiae sodium channel pro... 26 1.2 AY615610-1|AAU05067.1| 71|Anopheles gambiae sodium channel pro... 26 1.2 AY615609-1|AAU05066.1| 71|Anopheles gambiae sodium channel pro... 26 1.2 AY615608-1|AAU05065.1| 71|Anopheles gambiae sodium channel pro... 26 1.2 AY615571-1|AAU05028.1| 62|Anopheles gambiae sodium channel pro... 26 1.2 AY615570-1|AAU05027.1| 71|Anopheles gambiae sodium channel pro... 26 1.2 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 26 1.2 DQ263748-1|ABB84470.1| 78|Anopheles gambiae para-type sodium c... 24 3.7 DQ022109-1|AAY51997.1| 66|Anopheles gambiae voltage-gated sodi... 24 3.7 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 24 4.9 DQ022108-1|AAY51996.1| 66|Anopheles gambiae voltage-gated sodi... 23 6.5 AY748834-1|AAV28182.1| 171|Anopheles gambiae cytochrome P450 pr... 23 6.5 AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl c... 23 8.6 >Y13592-1|CAA73920.1| 136|Anopheles gambiae voltage-gated sodium channel protein. Length = 136 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+LV Sbjct: 79 SMWDCMLVGDVSCIPFFLATVVIGNLV 105 >AY615653-1|AAU05110.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+LV Sbjct: 36 SMWDCMLVGDVSCIPFFLATVVIGNLV 62 >AY615652-1|AAU05109.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+LV Sbjct: 36 SMWDCMLVGDVSCIPFFLATVVIGNLV 62 >AY615651-1|AAU05108.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+LV Sbjct: 36 SMWDCMLVGDVSCIPFFLATVVIGNLV 62 >AY615650-1|AAU05107.1| 62|Anopheles gambiae sodium channel protein. Length = 62 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+LV Sbjct: 36 SMWDCMLVGDVSCIPFFLATVVIGNLV 62 >AY615649-1|AAU05106.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+LV Sbjct: 36 SMWDCMLVGDVSCIPFFLATVVIGNLV 62 >AY615648-1|AAU05105.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+LV Sbjct: 36 SMWDCMLVGDVSCIPFFLATVVIGNLV 62 >AY615647-1|AAU05104.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+LV Sbjct: 36 SMWDCMLVGDVSCIPFFLATVVIGNLV 62 >AY615646-1|AAU05103.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+LV Sbjct: 36 SMWDCMLVGDVSCIPFFLATVVIGNLV 62 >AY615628-1|AAU05085.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+LV Sbjct: 36 SMWDCMLVGDVSCIPFFLATVVIGNLV 62 >AY615618-1|AAU05075.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+LV Sbjct: 36 SMWDCMLVGDVSCIPFFLATVVIGNLV 62 >AY615617-1|AAU05074.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+LV Sbjct: 36 SMWDCMLVGDVSCIPFFLATVVIGNLV 62 >AY615616-1|AAU05073.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+LV Sbjct: 36 SMWDCMLVGDVSCIPFFLATVVIGNLV 62 >AY615615-1|AAU05072.1| 69|Anopheles gambiae sodium channel protein. Length = 69 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+LV Sbjct: 36 SMWDCMLVGDVSCIPFFLATVVIGNLV 62 >AY615614-1|AAU05071.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+LV Sbjct: 36 SMWDCMLVGDVSCIPFFLATVVIGNLV 62 >AY615612-1|AAU05069.1| 69|Anopheles gambiae sodium channel protein. Length = 69 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+LV Sbjct: 36 SMWDCMLVGDVSCIPFFLATVVIGNLV 62 >AY615610-1|AAU05067.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+LV Sbjct: 36 SMWDCMLVGDVSCIPFFLATVVIGNLV 62 >AY615609-1|AAU05066.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+LV Sbjct: 36 SMWDCMLVGDVSCIPFFLATVVIGNLV 62 >AY615608-1|AAU05065.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+LV Sbjct: 36 SMWDCMLVGDVSCIPFFLATVVIGNLV 62 >AY615571-1|AAU05028.1| 62|Anopheles gambiae sodium channel protein. Length = 62 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+LV Sbjct: 36 SMWDCMLVGDVSCIPFFLATVVIGNLV 62 >AY615570-1|AAU05027.1| 71|Anopheles gambiae sodium channel protein. Length = 71 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+LV Sbjct: 36 SMWDCMLVGDVSCIPFFLATVVIGNLV 62 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+LV Sbjct: 994 SMWDCMLVGDVSCIPFFLATVVIGNLV 1020 >DQ263748-1|ABB84470.1| 78|Anopheles gambiae para-type sodium channel variant 1 protein. Length = 78 Score = 24.2 bits (50), Expect = 3.7 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+ V Sbjct: 33 SMWDCMLVGDVSCIPFFLATVVIGNFV 59 >DQ022109-1|AAY51997.1| 66|Anopheles gambiae voltage-gated sodium channel protein. Length = 66 Score = 24.2 bits (50), Expect = 3.7 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+ V Sbjct: 27 SMWDCMLVGDVSCIPFFLATVVIGNFV 53 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.8 bits (49), Expect = 4.9 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +1 Query: 109 RPVDMYQRTEHELRQKESNIRRNRRRTAVPQRLLQDRERR 228 R + + E ELR++ +R + + QR ++RER+ Sbjct: 462 REAAIEREKERELREQREREQREKEQREKEQREKEERERQ 501 >DQ022108-1|AAY51996.1| 66|Anopheles gambiae voltage-gated sodium channel protein. Length = 66 Score = 23.4 bits (48), Expect = 6.5 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -3 Query: 204 SLWNCXXXXXXSDIGFFLSQLMLGSLV 124 S+W+C S I FFL+ +++G+ V Sbjct: 27 SMWDCMLVGDVSCIPFFLATVVIGNSV 53 >AY748834-1|AAV28182.1| 171|Anopheles gambiae cytochrome P450 protein. Length = 171 Score = 23.4 bits (48), Expect = 6.5 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +1 Query: 196 PQRLLQDRERRTDQSK*FVPFSSFSENDRTESFARFD 306 P R R+ +T ++PFS+ S N + FA+++ Sbjct: 101 PDRFEGARDAQTFNPYTYIPFSAGSRNCIGQKFAQYE 137 >AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl cyclase beta subunit protein. Length = 649 Score = 23.0 bits (47), Expect = 8.6 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +2 Query: 20 MNLFEAVNSDCETLDVXXXXXXKEASPTEDDPSTCTSEPSMS 145 + + +AV S +DV ++ P E + T+EP ++ Sbjct: 144 IGIVKAVASKLHGVDVEIKIIRRKGDPVEPEAKKATAEPPVA 185 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 614,631 Number of Sequences: 2352 Number of extensions: 11457 Number of successful extensions: 45 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66068490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -