BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10p05 (745 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 23 4.0 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 5.3 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 5.3 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 5.3 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 5.3 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 7.0 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 7.0 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 7.0 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 9.2 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 9.2 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 9.2 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/28 (28%), Positives = 16/28 (57%) Frame = -1 Query: 670 SINSKKSDIYHLINLYKPVIIAIQETWL 587 S N ++ Y LI +Y P ++ + +W+ Sbjct: 237 SFNLQRHTGYFLIQVYVPCVLIVVLSWV 264 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.2 bits (45), Expect = 5.3 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = -2 Query: 498 IIQYLLTTFLLQTIALI 448 I +YLL TF++ T++++ Sbjct: 296 IAKYLLFTFIMNTVSIL 312 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.2 bits (45), Expect = 5.3 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 254 YSCTIVTGIGATPSLVLCIKI 316 Y C V GIGA S V+ I + Sbjct: 753 YLCEAVNGIGAGLSAVIFISV 773 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.2 bits (45), Expect = 5.3 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 416 YFINTYCYYREINAMVCNRNVVKRYCIMNK 505 +F NT+CY+R NA +N V+ ++K Sbjct: 533 WFQNTFCYFRR-NAATW-KNAVRHNLSLHK 560 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.2 bits (45), Expect = 5.3 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 Query: 443 REINAMVCNRNVVKRYCIMNK*SYTSIAICSI 538 RE N +VCN V Y I I +C++ Sbjct: 801 REDNLLVCNSYVDASYMIAFAYPIMLIVVCTV 832 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 7.0 Identities = 9/39 (23%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = -1 Query: 697 STTLQWNCRSINS--KKSDIYHLINLYKPVIIAIQETWL 587 + T +++C ++ K+ Y+LI +Y P + + +W+ Sbjct: 223 TNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWV 261 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.8 bits (44), Expect = 7.0 Identities = 9/39 (23%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = -1 Query: 697 STTLQWNCRSINS--KKSDIYHLINLYKPVIIAIQETWL 587 + T +++C ++ K+ Y+LI +Y P + + +W+ Sbjct: 223 TNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWV 261 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.8 bits (44), Expect = 7.0 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -1 Query: 145 PGLASLLTWKTLSSTYDS 92 P + + W T+ TYDS Sbjct: 152 PAMELVYAWSTIDYTYDS 169 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.4 bits (43), Expect = 9.2 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -3 Query: 149 HPWLSFLTDLENTFLY 102 HPWL L + +T +Y Sbjct: 544 HPWLPLLRNRLDTLIY 559 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.4 bits (43), Expect = 9.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 475 CGQKVLYYEQVKLHQHSH 528 CG+ Y +KLHQ +H Sbjct: 237 CGKSFGYNHVLKLHQVAH 254 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.4 bits (43), Expect = 9.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 253 IFLHHSNWNWCYPKLGAV 306 I LHH +W+ YP G + Sbjct: 205 INLHHWHWHLVYPFEGDI 222 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,355 Number of Sequences: 438 Number of extensions: 4600 Number of successful extensions: 19 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23266665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -