Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmov10o24
         (561 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X91618-1|CAA62821.1|  524|Tribolium castaneum hunchback protein.       23   1.8  
AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxida...    21   7.2  
AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    21   7.2  

>X91618-1|CAA62821.1|  524|Tribolium castaneum hunchback protein.
          Length = 524

 Score = 23.0 bits (47), Expect = 1.8
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = +2

Query: 239 APPNEKPEIVKTHLRNMIIVPEMVGSIVGIYNGKT 343
           A PN KP+  + HLR +    EM     G+++ KT
Sbjct: 134 ASPNRKPDDNQDHLRRL----EMSLEKSGLFSSKT 164


>AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxidase
           subunit 1 protein.
          Length = 682

 Score = 21.0 bits (42), Expect = 7.2
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = +3

Query: 186 LNVNQWHW 209
           LN++ WHW
Sbjct: 203 LNLHHWHW 210


>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 21.0 bits (42), Expect = 7.2
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -2

Query: 542 YFYCNLM*VLC 510
           YFYC L+ +LC
Sbjct: 287 YFYCALIILLC 297


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 115,140
Number of Sequences: 336
Number of extensions: 2155
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 13786212
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)