BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10o24 (561 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 23 1.8 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 21 7.2 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 7.2 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 23.0 bits (47), Expect = 1.8 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 239 APPNEKPEIVKTHLRNMIIVPEMVGSIVGIYNGKT 343 A PN KP+ + HLR + EM G+++ KT Sbjct: 134 ASPNRKPDDNQDHLRRL----EMSLEKSGLFSSKT 164 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 21.0 bits (42), Expect = 7.2 Identities = 5/8 (62%), Positives = 7/8 (87%) Frame = +3 Query: 186 LNVNQWHW 209 LN++ WHW Sbjct: 203 LNLHHWHW 210 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.0 bits (42), Expect = 7.2 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -2 Query: 542 YFYCNLM*VLC 510 YFYC L+ +LC Sbjct: 287 YFYCALIILLC 297 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,140 Number of Sequences: 336 Number of extensions: 2155 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13786212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -